KEGG   Azospirillum brasilense Sp245: AZOBR_200166Help
Entry
AZOBR_200166      CDS       T02152                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex,thiamin-binding component (E1)
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZOBR_200166 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    AZOBR_200166 (sucA)
   00380 Tryptophan metabolism
    AZOBR_200166 (sucA)
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AZOBR_200166 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2957766..2960690
Genome map
AA seq 974 aa AA seqDB search
MSANLEKTSFLFGSNAEYVAELYARFLKDPSSVDSSWNGFFRELDDDSRAVLNELNGPSW
SLEEGTLANGALDPIAASLESIGAPAATNGNAGLVAHAQQVYGGISHQQLRAATLDSIRA
LMLIRVYRVRGHMNAHFDPLGLEKREPHPELDPATYGFGPGDMDRPIFLNYSLGLETASL
RQILEILQKTYCGNIGVEFMHIQDPEEKAWIQERIEGGRNHTDFTVNGKRAIYERLIAAE
GFEKFLQLKYTGTKRFGLEGGESMIPALEQILKRGGQLGLKEVVVGMAHRGRLNMLTNFM
GKPFAAVFSEFQGNPSSPQDVQGSGDVKYHLGTSSDRDFNGNIVHLSLTANPSHLEWVNP
VVLGKVRAKQAQRNDLEREQVMGVLIHGDAAFAGQGIVAETLGLSELRGYRTGGTVHFII
NNQIGFTTNPTYSRSGVYCSDMAKMVQAPIFHVNGDDPESVVHISRIAAEFRQKFKRDVV
IDMVCYRRHGHNEGDEPGFTQPLMYKKIRAHGTTRELYGKQLVEENVLTQAESDQMIQDF
MKKLEGEFEAANSFKPNKADWLEGKWSGLEAAKTDDERKGNTGVAIDVLREVGNKLCEYP
KDFAINSKIARQLEAKKKSLETGEGIDWATAEALAYGTLLVEGNGVRLSGQDSGRGTFSH
RHAVMYDQNTENKYIPLNHLRPDQGPFEVHDSPLSEAAVVGFEYGYSLAEPHSLTLWEAQ
FGDFANTAQTIIDQFLSSGESKWLRMSGLVLLLPHGYEGQGPEHSSARPERFLQMSAEDN
WQICNLTTPANLFHAFRRQMRRPFRKPLVLFTPKSLLRHKLCVSSLSELAEGTNFRRVLG
ETATDLLPNEQIRRIVVCTGKVYYDLLQERTARGIKDVALVRLEQLYPFPRSALTEEFAR
YPNAEVVWCQEEPENQGYWAFVDRRLEGALTSIEHKASRPSYVGRPASASPATGLLKRHN
QEQAKLLEDALVIR
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctaatctggagaagacctcgttcctgttcggctcgaacgccgaatatgtcgcg
gagttgtacgcgcgcttcctgaaggacccctcctcggtggattcgagctggaacggcttc
ttcagggagctggacgacgactcccgcgccgtcctgaacgagctgaacggcccgtcctgg
agcctggaggagggcacgctcgccaacggcgcgctcgaccccatcgccgcctcgctggaa
agcatcggcgctccggccgcgaccaacggcaacgccggcctcgtcgcccacgcccagcag
gtctatggcggcatcagccaccagcagctgcgcgccgcgacgctcgacagcatccgcgcg
ctgatgctcatccgcgtctaccgcgtgcgcggccacatgaacgcgcatttcgacccgctg
ggtctcgagaagcgcgagccgcacccggaactcgatccggcgacctacggcttcggcccg
ggcgacatggaccgcccgatcttcctgaactactcgctgggcctggagacggcgtcgctg
cgccagatcctggagatcctgcagaagacctactgcgggaacatcggcgtcgagttcatg
cacatccaggaccccgaagagaaggcctggatccaggagcgcatcgagggtggccgcaac
cacaccgacttcacggtgaacggcaagcgcgccatctacgagcgcctgatcgccgccgag
ggcttcgagaagttcctgcagctcaagtacaccggcaccaagcgcttcggccttgagggc
ggcgagtcgatgatccccgcgctggagcagatcctgaagcgcggcggccagctcggcctc
aaggaggtcgtcgtcggcatggcccaccgcggtcgcctgaacatgctgaccaacttcatg
ggcaagcccttcgccgcggtcttctcggagttccagggcaacccgtccagcccgcaggac
gtgcagggctcgggcgacgtgaagtaccatctcggcacctcgtcggaccgcgacttcaac
ggcaacatcgtccacctgtcgctgaccgccaacccgtcccacctggaatgggtgaacccg
gtcgtgctgggcaaggtgcgcgccaagcaggcgcagcgcaacgacctggagcgcgagcag
gtcatgggcgtgctgatccacggcgacgccgccttcgccggccagggcatcgtggccgag
acgctgggcctgtcggagctgcgcggctaccgcaccggcggcaccgtgcacttcatcatc
aacaaccagatcggcttcaccacgaacccgacctattcgcggtccggcgtctactgctcg
gacatggcgaagatggtccaggcgccgatcttccacgtcaacggcgacgatcccgagtcc
gtcgtccacatcagccgcatcgccgccgagttccgccagaagttcaagcgggacgtggtg
atcgatatggtctgctaccgccgccacggccacaacgagggcgacgagccgggcttcacc
cagccgctgatgtacaagaagatccgcgcccacggcaccacgcgggagctgtacggcaag
cagctcgtcgaggagaacgtcctcacccaggccgagtccgatcagatgatccaggacttc
atgaagaagctggagggtgagttcgaggccgccaactccttcaagccgaacaaggccgac
tggctggaaggcaagtggtcgggccttgaggccgcgaagaccgacgacgagcgcaagggc
aacaccggcgtggcgatcgacgtgctgcgcgaggtcggcaacaagctctgcgagtatccg
aaggacttcgcgatcaattcgaagatcgcccgtcagctcgaagccaagaagaagtcgctg
gagaccggcgagggcatcgactgggcgaccgcggaagcgctggcctacggcacgctgctg
gtcgagggcaacggcgtccgcctgtcgggccaggattccggccgcggcaccttctcgcac
cgccacgcggtgatgtacgaccagaacaccgagaacaagtacatcccgctgaaccacctg
cgccccgaccagggcccgttcgaggtgcatgacagcccgctgtccgaggcggccgtcgtc
ggcttcgaatacggctactcgctggccgagccgcacagcctgaccctgtgggaggcgcag
ttcggcgacttcgccaacaccgcccagaccatcatcgaccagttcctctcgtcgggcgag
tcgaagtggctgcgcatgtccggcctcgtgctgctgctgccgcacggctacgagggccag
ggtccggagcactcctcggcccgtccggagcgcttcctccagatgtccgccgaggacaac
tggcagatctgcaacctgacgaccccggcgaacctgttccacgccttccgccgccagatg
cgccgccccttccgcaagccgctggtgctgttcacgccgaagtcgctgctgcgccacaag
ctgtgcgtctccagcctgtcggagctggccgagggcacgaacttccgccgcgtgctcggc
gagacggcgaccgacctgctgccgaacgagcagatccgccgcatcgtggtctgcaccggc
aaggtctattacgacctgctgcaggagcgcaccgcgcgcggcatcaaggacgtggcgctg
gtccggctggagcagctctacccgttcccccgctccgccctgaccgaggagttcgcccgt
tacccgaacgccgaggtggtgtggtgccaggaggagccggagaaccagggctactgggcc
ttcgtcgaccgccgtctggaaggcgccctcacctcgatcgagcacaaggcctcgcgcccc
agctacgtcggccgtccggcctccgcgtcgccggccaccggcctgctcaagcgtcacaac
caggagcaggcgaagcttctggaagacgcgctcgtcatccgctga

DBGET integrated database retrieval system