KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT147551Help
Entry
AGABI2DRAFT147551 CDS       T03140                                 

Gene name
AGABI2DRAFT_147551
Definition
(RefSeq) hypothetical protein
  KO
K20182  vacuolar protein sorting-associated protein 33
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:abv00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    AGABI2DRAFT147551 (AGABI2DRAFT_147551)
Membrane trafficking [BR:abv04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    AGABI2DRAFT147551 (AGABI2DRAFT_147551)
   Hops complex
    AGABI2DRAFT147551 (AGABI2DRAFT_147551)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec1 SpoIIIAH
Motif
Other DBs
NCBI-GeneID: 18079168
NCBI-ProteinID: XP_006454186
JGI: Agabi_varbisH97_2_147551
LinkDB All DBs
Position
Unknown
AA seq 655 aa AA seqDB search
MAHRDLANDSDSTDALEVSVLRDVAKKSLVDALNSVNGAKTLVLDASLAGPLGLITEVSL
LKQHGVDKMFWLEAGPLNATTTNIIYLTRPSIKHVKIIADQIKQHARESQKHNYTVLLVP
RFSTLVSRILEEEGVLGEVTLSTYNLQFIPIADDVISLEREDAFRELWVDGDETVIFDSA
QALIALQNRFGTFPRIIGKGDYAGTGSKSLAPSQSLTSPTIDSLLILDRRVDMITPFLTQ
LTYEGLIDELIGIKNSHVELPVSLLAPPNPQSTTGAASTSQTPAASITVKKENKKKHHFT
TTTDPLYAEIRDLNFSNVGRKLNKVAHTLDQNYKTNLESKTPAQLRDFVGKLSGLRTEHQ
ALKLHTGLSELLVPSTRTELFNKSLEIQQNLLASYEVNNQISAIEDMIARGAELHIVLRL
LCLACIVTGGVKIKVLENLKREILQAYGYEYLPLLLSLASPPLSLLLPTPLPPSATINKY
PYSTLRKSLRLLIDDNLEALEEVENDISYVYSGFAPISIRLVQCVAQKGGVLSNPAEREK
AGSENPTMTARASSKVRAHPILGWKGFEDVVDAIPGETIDIVTNFSDIERTSTTVVFFLG
GCTYTEIAALRWVARQSTGRKFLIATTGMVSGASIIEGISGVGKKTGTKTSAGIQ
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatagagatcttgcaaatgattcagactcgaccgatgcactggaagtgagtgta
ctccgtgacgtagcgaagaagtctctagtagatgcgttgaattcggtgaatggtgcaaag
acgctcgtccttgatgcttcactagcagggcctttgggtctcattacggaagtttcactg
ctgaagcaacatggtgtcgataagatgttttggctggaggccggtccactgaatgcgacg
actaccaacatcatctatctcactcgaccgtcaattaaacatgtcaagataattgctgac
caaatcaaacaacatgcacgtgaatctcaaaaacataattatactgttcttctcgtcccc
agattttcgactttggtgtcgcgcattcttgaagaggaaggtgtattaggcgaagtgact
ttgtcgacatacaatcttcaatttattcccattgccgatgatgtaatttcactggaaaga
gaagacgcattcagagagttgtgggtggatggcgacgaaacagttatctttgattcagca
caagcacttatcgcactgcaaaaccgattcggaacatttcctcgtatcatcgggaaaggt
gactatgccgggactggttcgaaatcacttgcaccctcgcaatcactaacttcaccaaca
attgattcactccttatccttgatcgacgggtggatatgatcactcctttcttgacacaa
ttgacatacgaaggacttattgacgaacttatcggaatcaagaattcacacgtagaactg
cctgtttcgcttttggcacctccgaatcctcagagtactaccggtgcggcatctacatcg
caaacaccggcagcatctatcaccgtcaagaaagaaaacaaaaagaagcatcatttcact
acgaccacggatcctttgtatgccgaaattagggatctgaacttctccaatgtggggagg
aagttaaataaagttgcgcatactttggatcagaattacaagaccaatttggagtcaaag
acgccggcgcagctgcgagatttcgtcgggaaactcagtggcttgcgaacagaacatcag
gctctcaaattgcacacagggctgtctgaattgctggtcccttctaccaggacggagctg
ttcaacaagtctttggaaattcagcaaaatcttctcgcttcgtatgaggtcaataaccag
ataagcgccatcgaagacatgattgcccgaggtgcagaacttcacatagttctacgtctc
ttgtgtctggcatgcattgtaactggaggagtaaaaatcaaagttctagaaaatttgaag
cgggaaatcctgcaggcttatggctatgaatatctgcctctcctgttgtccttggcatcc
ccaccgctgtctcttctgctaccaacgccactgccgcccagtgcaacgatcaacaaatat
ccatattcgacccttcgaaagtcgcttcgccttctgattgatgacaatctcgaagcattg
gaagaggttgaaaatgacatcagttacgtgtattcgggttttgcaccaatttctattcga
cttgttcagtgtgtcgctcaaaagggtggtgttttgagcaacccggcggaaagagaaaag
gccgggtctgaaaatccaacgatgaccgcgagggcgtccagtaaagtgcgcgcacatcct
atcctgggctggaaaggttttgaagacgttgtcgatgcaattccgggagaaacaatagac
atagtaacaaacttttccgacattgaacgtacctctaccacggttgtgttcttccttggt
ggttgtacctatacggagattgcagcgttgcgctgggtagcaaggcaaagtacaggacgt
aagtttttgattgcgacgactggtatggtgagcggtgctagtatcattgaggggatatct
ggcgttgggaagaagacagggaccaagacgagcgctggtatacaatag

DBGET integrated database retrieval system