KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT194802Help
Entry
AGABI2DRAFT194802 CDS       T03140                                 

Gene name
AGABI2DRAFT_194802
Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:abv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
   00051 Fructose and mannose metabolism
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
   00052 Galactose metabolism
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
   00500 Starch and sucrose metabolism
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
   00520 Amino sugar and nucleotide sugar metabolism
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
Enzymes [BR:abv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AGABI2DRAFT194802 (AGABI2DRAFT_194802)
Membrane trafficking [BR:abv04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AGABI2DRAFT194802 (AGABI2DRAFT_194802)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MVASRRGSGTLTLPSGQTLAYHTRTHDEEGLPHATKKTMADHLRRLESLFTLTPQRMRMI
VEAFKEALETGLEKNDQVVPMIPTYVFGWPTSKEQGDFLALDLGGTNLRVCLVTVQGNGQ
FELTQSKYRLTEEQKQDDGQKLFDFCAECLKTFIESNFSGENEVKAPAKLPLGFTFSYPC
SQAKIDHGVLIRWTKGFGAPNTEGNDVAAMFRKSLEKYQLPVTLTALINDTTGTLLASHY
VNPKTKIAVIFGTGCNAAYMERVENIPKISKLGIDPSSEMAINCEWGAFDSFEHEHLPRT
KYDTIVDESSNKPGEQAFEKLISGRYLGEILRLVICELIDDGVLFLGQNTYKLEVAYCFD
TAFLSLMESDPTDELLMIIGIFSHFFAVETTLAERQFFRALAKLIGKRAARLSACGIAAI
VSKMGYLDEGCLVGADGSLYNKYPGFPDRVHEGLVDIFGDKGRNILTCRAEDGSGVGSAI
IAAMTKVRKDAGIYPDL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggttgcttcacgcaggggctccggaacgctcactttgccctccggccagactttggcc
taccacacaaggacccacgatgaggagggtctgccccacgcaacaaaaaagacaatggca
gatcacctccgtcgtctcgagagcctattcacgttgacccctcaaagaatgcggatgatc
gtcgaagctttcaaagaagcgctcgaaaccggtcttgagaaaaatgatcaggtcgttcca
atgatcccgacatatgtctttggatggccaacaagcaaggaacaaggtgactttctcgcg
ttagatctcgggggcaccaaccttcgtgtttgccttgtgactgtccaggggaatggacaa
ttcgaacttacccaatctaaataccgtttgacggaggagcaaaagcaggacgacgggcaa
aaactgtttgacttctgcgccgagtgtctcaagacgttcatcgaaagcaacttcagcgga
gaaaacgaggtcaaagcacctgcaaaactcccccttggctttaccttttcatacccctgc
tcgcaagcaaagatcgatcatggtgttcttatccgctggaccaaaggtttcggtgcccca
aatacggaaggtaacgatgtcgccgcgatgtttcgcaagtctctagaaaaataccaactc
ccagtgacgctcactgccctcatcaatgacacaactggaacgctgctcgcatcacattac
gtgaacccaaaaaccaaaatcgctgtcatctttgggacggggtgcaatgcagcatatatg
gagcgtgtcgaaaacattcccaagatttcaaaactaggaatagacccatcttcggagatg
gcaattaactgtgaatggggcgcttttgactcgttcgagcatgagcatctaccaaggacc
aaatatgatacgatcgtagacgaatcttctaacaaacccggggaacaggcttttgaaaaa
cttatctctggccgttatttgggcgagattctcagattggtcatatgtgaactcatagac
gatggtgttctgttcctcggtcagaacacatacaaactggaggttgcgtattgtttcgac
actgccttcttgtcattgatggaaagtgacccaacggacgaattgcttatgatcattggc
atcttctcacatttcttcgctgtcgagactacccttgcggaacgccaattcttccgtgcg
ctggcaaaactcattggtaaacgtgctgcgcgcttgagcgcttgtggtattgctgccatc
gttagcaagatgggatacttggatgaaggatgcttggttggcgctgatggcagtttgtat
aacaaatatcctggattcccggatagagtgcatgaaggtcttgtggatattttcggtgat
aaaggacggaacatcttaacgtgccgtgcagaagatggaagtggagtgggtagcgctatc
atcgcagccatgaccaaagttaggaaagatgctgggatctatcccgatctttaa

DBGET integrated database retrieval system