KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT214235Help
Entry
AGABI2DRAFT214235 CDS       T03140                                 

Gene name
AGABI2DRAFT_214235
Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv03030  DNA replication
abv03410  Base excision repair
abv03420  Nucleotide excision repair
abv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:abv00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AGABI2DRAFT214235 (AGABI2DRAFT_214235)
   03410 Base excision repair
    AGABI2DRAFT214235 (AGABI2DRAFT_214235)
   03420 Nucleotide excision repair
    AGABI2DRAFT214235 (AGABI2DRAFT_214235)
   03430 Mismatch repair
    AGABI2DRAFT214235 (AGABI2DRAFT_214235)
Enzymes [BR:abv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AGABI2DRAFT214235 (AGABI2DRAFT_214235)
    6.5.1.6  DNA ligase (ATP or NAD+)
     AGABI2DRAFT214235 (AGABI2DRAFT_214235)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AGABI2DRAFT214235 (AGABI2DRAFT_214235)
DNA replication proteins [BR:abv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AGABI2DRAFT214235 (AGABI2DRAFT_214235)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AGABI2DRAFT214235 (AGABI2DRAFT_214235)
DNA repair and recombination proteins [BR:abv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AGABI2DRAFT214235 (AGABI2DRAFT_214235)
   NER (nucleotide excision repair)
    Other NER factors
     AGABI2DRAFT214235 (AGABI2DRAFT_214235)
   MMR (mismatch exicision repair)
    Other MMR factors
     AGABI2DRAFT214235 (AGABI2DRAFT_214235)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF4746
Motif
Other DBs
NCBI-GeneID: 18084800
NCBI-ProteinID: XP_006454327
JGI: Agabi_varbisH97_2_214235
LinkDB All DBs
Position
Unknown
AA seq 822 aa AA seqDB search
MGRQQTLGKFFEMPKGLKNAPPQQSSLLDMWGKGKRKAVSGPKKEEADEDIVPENNKMDA
NKPGESSSQSEITKIGPPSKRRRIVTSDDDEPSSSVRRTINSPTVGTSPPVSRTSSPQSS
PPPKSKKARIPVRAAASEAESEAAATSEPSDDDGEEEIERDEQEDNDESIMAVEGAALLR
IKEVDIPGGWKVGQPVPYAALAKTFSLIESTTKRLEKNSYLTSFLLLVIQRSAKGDWNSL
LQTVYLCINRLSPDYEGIELGIGESLLIKAIAESTGRSLAVIKADLKREGDLGLVAMNSK
TSQKTLFKPKPLTLPFVFSHLKDIATTSGHSSQAKKVSIITKLLAACQGLEAKYIIRSLE
GKLRIGNAERSVLVAIANAVVLAEKEASNRNWSNEKLIKRLEESTLRIKSVYSELPNYDK
VIPALLDVGIDGLEEVCKLTPGVPLKPMLAKPTKAIGEVLDRFENQHFTCEYKYDGERAQ
VHKLEDGSVAVFSRNSEDMSKKYPDLVEQLPKCIKETTKSFVLDAEAVAIDRKTGKLMPF
QELSRRKRKDVKVEDIQVRVCLFAFDLLYLNGEPLLRKPLSERRKLLLEHFQPIDGEFNF
AKASNSQSVEEIQAFLEESVKDGCEGLMVKMLDGEPSFYEPSRRSVNWLKLKKDYLAGVG
DSLDLVVVGGYYGKGKRTNVYGAFLLACFDPDSEEYQTICKIGTGFSDEILQSHYNELKP
LELEKARGDVNIGGAKPDIWFEPKIVWEVLTADLSLSPIYTAAHGTVDERGISLRFPRFI
RVRDDKHVEDATASEQVAEMYGRQALANRDGKKKGGDDDGFW
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtcagcaaacattgggtaaattctttgaaatgccaaaaggtttgaagaatgcc
cctccccagcagtcaagtctgctagacatgtggggtaagggaaagcggaaggctgtcagt
ggacctaagaaggaagaggcggacgaggatatagtgcccgagaacaataaaatggatgca
aacaaaccaggcgaaagctcctcgcagagtgaaataaccaaaattggcccaccgtcaaaa
aggcgcagaatagtcacctcagacgacgatgaaccatcttcaagtgttcggcgaactatc
aactctccaactgttgggacctctcctcccgtttccaggacatcttcaccccaatcctca
ccacctccgaaatccaaaaaagcgagaatacccgttcgagcagctgcctcggaggctgaa
tcggaagcggccgcaacgtctgaaccaagtgacgatgatggtgaagaagaaattgagagg
gatgaacaagaagataacgatgagagcattatggctgtagaaggagctgcccttttacga
atcaaagaagttgacatacccggaggatggaaagttgggcagcctgttccctacgcagct
ctggcgaaaacattttccctcatagaaagcaccactaagcgtttagaaaagaattcatac
cttacatcgttcctgttactagtcatacaacgcagcgcaaagggcgattggaattcgctc
ctacaaacagtttacctctgcatcaatcggttatcaccagactatgaaggcattgagctt
ggcattggcgaaagtttgttgataaaagcaatcgcagaatcaactggtcgaagtttggcg
gtgattaaagcagacttgaaacgagaaggtgatttgggacttgtcgcaatgaattcgaaa
actagccagaaaactctttttaaacccaagccactaacccttcctttcgtattctctcat
ctcaaagacattgctactacgagtgggcactcctctcaagcaaagaaggtttcaatcatc
accaaacttctcgcggcatgtcaaggcttggaggccaaatacattatccgtagtctggaa
ggcaaactacgcatcggcaatgccgagcgatcagttctagtcgctattgcgaatgctgtt
gtcctggcagaaaaagaggcatccaacagaaattggtcaaatgagaagttaatcaaacga
ctggaagaatccactctcagaatcaagtcggtttatagtgaattgccaaactatgacaag
gtcatccctgctcttctcgatgtaggtattgatggtctggaggaagtgtgcaaattgaca
ccaggtgtccctttaaaacctatgctagcgaaacctaccaaggcaattggcgaagtcctt
gatagattcgaaaaccagcatttcacttgcgagtacaaatacgatggagagcgtgcccaa
gtacacaaattagaagacggtagtgtcgcggtcttcagtcgaaattctgaagatatgagt
aagaaatatcccgatctcgtggaacaattgcccaagtgcatcaaagaaacgactaaatca
ttcgtgctcgatgcggaggctgttgcaatagaccggaaaacggggaagcttatgcccttc
caggagctaagtcgacggaaacgcaaggacgtcaaagtagaggatatccaagttcgagtg
tgtttgttcgcctttgatttattataccttaatggcgagcccctgctacgcaaacctttg
tcagagaggaggaaacttttacttgaacatttccaacctattgacggagagttcaacttt
gccaaggcgtcgaatagtcaatcagttgaagagatccaagctttccttgaggagagtgtg
aaggacggttgtgaagggttgatggtgaagatgttggatggcgagcctagcttttatgag
ccaagtcggcgtagtgtcaactggctgaagctcaaaaaggattatctggctggtgttggg
gattctttggatttggtcgtggttggtggttactatggcaaaggaaaacgaacaaacgtc
tatggagcctttctccttgcgtgttttgacccagactcggaagaataccaaaccatctgt
aaaattggaaccgggttcagtgatgagatcctccaatcacattacaacgaactcaaaccg
ctcgaattagaaaaggcgcgtggagatgtcaacatcggaggagctaaacccgacatctgg
tttgagccaaaaattgtgtgggaagtactcactgcggacttgagcttgagtcctatttat
actgccgctcacggaacggtggacgaacgaggcatttcgcttcgatttcctcgctttatc
agagtgcgagatgacaagcatgttgaggatgcaacagcatctgaacaggttgctgagatg
tatgggcgacaagctctcgcgaatagagatgggaagaagaaagggggtgacgacgacgga
ttttggtga

DBGET integrated database retrieval system