KEGG   Acinetobacter baumannii 1656-2: ABK1_1580Help
Entry
ABK1_1580         CDS       T01819                                 

Definition
(GenBank) sodB
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
abx  Acinetobacter baumannii 1656-2
Brite
Enzymes [BR:abx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ABK1_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1672845..1673471)
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLENLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatc
agtaaagaaactttagaataccatcacgacaaacaccacaatacctatgttgttaactta
aacaacttaatcaaaggtactgaccttgaaggtaaaactttagaagaaatcattaaggca
actgctggtgatgcatctaaagctggtattttcaacaatgctgctcaagtttggaaccac
actttctactggaacagcatgaagccaaacggtggtggtaagcctactggcgcaatcgct
gctaaaattgacgaagcttttggtagctacgaaaaatttgcagaagaatttactgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgatgaagtaaacggtaaa
ctttctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacacgcttactacatcgatttccgtaacttacgtcctaaa
tacatcgcaactttcttagaaaaccttgtgaactgggactatgcaaatgcaaaacttgca
ggccaaccagctggtgtagagaaataa

DBGET integrated database retrieval system