KEGG   Acinetobacter baumannii AYE: ABAYE0465Help
Entry
ABAYE0465         CDS       T00667                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00020  Citrate cycle (TCA cycle)
aby00270  Cysteine and methionine metabolism
aby00620  Pyruvate metabolism
aby00630  Glyoxylate and dicarboxylate metabolism
aby00680  Methane metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Module
aby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aby_M00012  Glyoxylate cycle
aby_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABAYE0465 (mdh)
   00620 Pyruvate metabolism
    ABAYE0465 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    ABAYE0465 (mdh)
  Energy metabolism
   00680 Methane metabolism
    ABAYE0465 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ABAYE0465 (mdh)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     ABAYE0465 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: CAM85438
UniProt: B0V6R7
LinkDB All DBs
Position
481392..482378
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEVPVEKAQQALKGVMMELD
DCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLLKVNGEIFIGQGQALNE
VASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRALTQVAQKAGVAVADI
EKLTVWGNHSPTMYADYRFATANGESLKDKINDPAWNKDVFLPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGTNGKWVTMGVPSDGSYGIPEGVMFGFPVTTENGEYKIVQGLE
IDEFSRERINFTLNELEEERAAIADMVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacccgttcgtgttgccgtgactggcgctgcaggtcaaattggttacagctta
ttattccgtatcgcaagcggtgaaatgctaggtaaagatcaacctgttattttacaattg
cttgaagttccagttgaaaaagcacaacaagcgcttaaaggcgtaatgatggaacttgat
gactgtgctttccctttattggctggcatgatcgggactgatgatcctaaagttgcattt
aaagatgctgactatgcgttattggtaggttctcgtccacgtggtcctggtatggaacgt
gctgacttgttaaaagttaacggcgaaatcttcattggccaaggtcaagcattaaacgaa
gttgctagccgtgacgttaaagtattagttgtaggtaatcctgcaaacacgaatgcttac
attgcgatgaaatctgctccagatcttccagcgaaaaacttcacagcaatgttgcgtctt
gaccacaaccgtgcgttgactcaagttgctcaaaaagctggtgttgctgtagctgacatc
gaaaaattaacagtttggggtaaccactctccaactatgtatgctgactaccgttttgca
actgctaatggtgaaagcttaaaagacaagatcaacgatccagcttggaacaaagacgta
ttccttccaactgttggtaaacgtggtgctgcgattatcgaagcgcgtggtttgtcttct
gctgcttctgctgctaacgctgcaatcgaccatatgcgtgattgggcacttggtacaaac
ggcaaatgggtaactatgggcgttccttctgacggttcttatggtattcctgaaggcgtt
atgttcggtttccctgtaacaactgaaaacggtgaatacaaaatcgttcaaggtttagaa
atcgatgaattcagccgtgagcgtatcaacttcactctaaacgagcttgaagaagaacgt
gcagcaattgctgacatggtaaaataa

DBGET integrated database retrieval system