KEGG   Actinoalloteichus sp. ADI127-7: UA74_24815Help
Entry
UA74_24815        CDS       T04639                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
acad  Actinoalloteichus sp. ADI127-7
Pathway
acad00010  Glycolysis / Gluconeogenesis
acad00030  Pentose phosphate pathway
acad00051  Fructose and mannose metabolism
acad00052  Galactose metabolism
acad00680  Methane metabolism
acad01100  Metabolic pathways
acad01110  Biosynthesis of secondary metabolites
acad01120  Microbial metabolism in diverse environments
acad01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UA74_24815
   00030 Pentose phosphate pathway
    UA74_24815
   00051 Fructose and mannose metabolism
    UA74_24815
   00052 Galactose metabolism
    UA74_24815
  Energy metabolism
   00680 Methane metabolism
    UA74_24815
Enzymes [BR:acad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UA74_24815
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     UA74_24815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PhoH
Motif
Other DBs
NCBI-ProteinID: APU16977
LinkDB All DBs
Position
complement(5859589..5860614)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVEVYGHEFVGFRNGWRGPIEGLTKPLGLDQVEDI
LTRGGTILGSSRTNPYKVEGGVDAIRATLADQGVDALVAIGGEDTLGVAKRLTDDGIGVV
GVPKTIDNDLNATDYTFGFDTAVHIATEAIDRLRTTAESHHRALVVEVMGRHAGWIALHS
GLAGGANVILTPEREFDIDQVVGWVERRFEREYAPIIVVAEGAVPKGGEAVLSHGEKDAF
GHVRLGGVGNWLAEEIATRTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLHAIDAVHDS
DFGVMVALRGTDIVRVKLAEATAELKTVPASRYAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggtgtgctcaccggcggcggcgactgtccgggtctgaacgcggtcatccgt
gcggtggtccgcaagggcgtcgaggtctacgggcacgaattcgtcgggttccgcaacggt
tggagaggcccgatcgagggactgaccaagccgctcgggctcgaccaggtggaggacatc
ctcaccaggggcgggaccatcctgggctcctccaggaccaacccgtacaaggtcgagggc
ggtgtcgacgccatccgcgcgacgttggccgaccagggtgtcgacgcgctggtcgcgatc
ggcggcgaggacaccctcggcgtggcgaagcggctgaccgacgacggcatcggcgtcgtc
ggcgtcccgaagacgatcgacaacgacctcaacgccaccgactacaccttcggcttcgac
acggcggtccacatcgccaccgaggccatcgaccgactgcggaccacggcggagtcccac
caccgcgcgctggtcgtggaggtcatgggccgtcacgcgggctggatcgcgctgcactcc
ggcctggccggtggcgcgaacgtgatcctgaccccggagcgcgagttcgacatcgaccag
gtcgtcggctgggtcgagcggcgcttcgagcgggagtacgccccgatcatcgtcgtcgcc
gagggcgcggtgcccaagggcggcgaggccgtgctcagccacggcgagaaggacgcgttc
ggccacgtccgcctcggcggcgtcggcaactggctggcggaggagatcgccaccaggacc
ggcaaggagtcgcgggcggtcgtcctcggccacgtccagcgcggcggcaccccgacggcc
tacgaccgggtgctggccacccgcttcggcctgcacgccatcgacgcggtgcacgactcc
gacttcggcgtgatggtcgccctgcgcggcaccgacatcgtccgggtcaagctggccgag
gccaccgccgaactcaagaccgtcccggcctcgcggtacgccgaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system