KEGG   Acanthamoeba castellanii: ACA1_165830Help
Entry
ACA1_165830       CDS       T02667                                 

Definition
(RefSeq) glutathione transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACA1_165830
Enzymes [BR:acan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ACA1_165830
Transporters [BR:acan02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACA1_165830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Tom37 GST_C_3
Motif
Other DBs
NCBI-GeneID: 14925385
NCBI-ProteinID: XP_004354059
UniProt: L8HGI5
LinkDB All DBs
Position
Unknown
AA seq 229 aa AA seqDB search
MGDEPIVIYGNPASQPSRAIMWFCHENSIPFEFKMVDLGKGENKTKEFVDLNPNKTVPVL
NDNGFVLYESAAILSYLARRFKVKDHWYPQDPRARGLVDQYLHWHHTHLRKGAASLFFYA
MIAPLFDGSRDFAEEKKAAILDLETSLQIIDARLANTQFIAGDEISIADMQAATEFTQHV
LANTYDFTGYANVTRWLGVLKEMPAYAKTHTPVAELFDQLRASSKLRSS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgaaccaatagtgatctacggcaatccggcgagccagccgtcgcgagcaatc
atgtggttctgccacgagaattcgataccgttcgaattcaagatggtcgacctcggcaaa
ggcgagaacaaaacaaaggaattcgtggacctcaatcccaacaaaaccgttcccgttctc
aacgataatggtttcgtgctctacgaaagtgccgcgatcttgtcctacttggctcgacga
ttcaaggtgaaggaccattggtacccacaggaccctcgtgcgcgcggactggtggaccag
tacctccactggcaccacactcacctgcgaaagggcgccgcttcgctctttttctacgcc
atgatagcgccgctgttcgacggatccagggactttgccgaagagaagaaggccgccatc
ttggacctggagacctcgcttcagatcatcgacgcacgactagccaacacccagttcatc
gccggggatgagatcagcatcgcggacatgcaggcggcgaccgagttcacgcagcacgtg
ctggcgaacacgtacgacttcacgggctatgccaacgtcacccgatggctgggcgtgctg
aaggagatgcccgcctacgccaagacccacacacccgtggccgagctgttcgaccagctc
cgagcctcgtccaagcttcgatcttcctag

DBGET integrated database retrieval system