Acinetobacter pittii: BDGL_000473 Help Entry BDGL_000473       CDS       T01684                                  Symbol mphM Name (RefSeq) phenol hydroxylase P2 protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism acc  Acinetobacter pittii Pathway acc00361   Chlorocyclohexane and chlorobenzene degradation acc00362   Benzoate degradation acc00623   Toluene degradation acc01100   Metabolic pathways acc01120   Microbial metabolism in diverse environments acc01220   Degradation of aromatic compounds Module acc_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:acc00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BDGL_000473 (mphM)    00361 Chlorocyclohexane and chlorobenzene degradation     BDGL_000473 (mphM)    00623 Toluene degradation     BDGL_000473 (mphM) Enzymes [BR:acc01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      BDGL_000473 (mphM)     1.14.13.244  phenol 2-monooxygenase (NADH)      BDGL_000473 (mphM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-GeneID:  11638651 NCBI-ProteinID:  YP_004994741 UniProt:  F0KIC1 LinkDB All DBs Position complement(517471..517737) Genome browser AA seq 88 aa AA seqDB search MSKVYLALQDNDTSRYIIEAIEEDNPEASIQYLPAMIRIESETDLVIKAETVSEKLGQDW DIQSLQLNMITLGGNVEEDDDTFRLHWN NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtctaaagtctatctcgcactacaagacaacgatacttcacgctacatcattgaggcg attgaagaagataaccctgaagcgtcaattcagtatttacccgccatgattcgcattgaa agtgaaactgatttggtgattaaagccgaaaccgtatctgaaaaactaggccaagattgg gacatccaatcgttacaactcaacatgattacgctgggcggcaacgtcgaagaagatgac gatactttccgccttcactggaattaa

DBGET integrated database retrieval system