KEGG   Acidothermus cellulolyticus: Acel_1378Help
Entry
Acel_1378         CDS       T00426                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ace  Acidothermus cellulolyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1536669..1537688)
Genome map
AA seq 339 aa AA seqDB search
MSDAVELTVGGRTVRISHPGKLYFPALGATKLDLVRYYLAVGDGIVRALYERPCTLQRFP
DGVDGKMIFQKRVPASRPDWIQTARVQFPSGRQADELCVIDFAAVIWAVNMGTIVFHPWP
SRRPDTEHPDELRIDLDPQPGTGFAEVRAVGRLVHELLDELGYRGFPKTSGGRGLHVLVR
IRPEWDFVAVRRAALAFAREIERRAPQLATSAWWKEERGARIFLDFNQNARDRTIAAAYS
VRANPRATVSTPISWAELDDAEPDDFTIATVPERFAAIGDLHRTIDDIAHDLSPLLEMAD
RDVRDRGLGDAPYPPNFPKMPGEPVRVQPSRARGARPVH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcggtggagctcaccgtaggcggccggaccgtacggatatcccatcccggc
aagctgtattttccggcgctcggcgcgaccaagctcgaccttgtccggtattacctcgcc
gtcggcgacggcatcgtgcgggcgttgtacgaacggccttgcacgttgcagcgctttccg
gacggcgttgacggaaagatgattttccagaagcgggtcccggcgtcacgccccgactgg
attcaaaccgccagagtgcagtttccgagcggccggcaagcggacgaattgtgcgttatc
gatttcgctgccgtgatttgggcggtcaatatggggacgatcgtctttcatccgtggccg
tcacggcgtcccgacaccgagcatccggacgagctccgcatcgaccttgacccacagccg
ggtacgggattcgccgaggtgcgtgcggtcgggcgactggttcatgagctgctcgatgaa
ctcgggtaccggggttttcccaagacgtccggcggtcgcggcctgcacgtcttggtgcgg
attcggccggagtgggatttcgtcgcggtacgacgcgccgcgcttgcgttcgcacgggaa
atcgaacgacgtgcaccgcagctggcgacaagcgcgtggtggaaagaggagcgcggcgcg
agaatcttcctggatttcaaccagaatgcgcgggaccgcaccatcgccgccgcctacagc
gtgcgggccaatccgcgcgccaccgtgtcaacacccatcagctgggcggagctggacgac
gccgaaccggacgatttcaccatcgcgaccgttcccgagcggttcgcggccattggcgac
ctgcaccggacgatcgacgacattgcccatgacctctcgccgttgttggagatggccgac
cgcgatgtccgcgaccgcggcctcggtgacgccccttatccgccgaatttcccgaaaatg
ccgggggaaccggtgcgtgtccagccaagccgggcccgcggcgcccggccggtccactag

DBGET integrated database retrieval system