KEGG   Atta cephalotes (leaf cutting ant): 105618474Help
Entry
105618474         CDS       T04923                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
Enzymes [BR:acep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105618474
Peptidases [BR:acep01002]
 Metallo Peptidases
  Family M2
   105618474
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105618474
CD molecules [BR:acep04090]
 Proteins
  105618474
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MIAQWNFATNVTDANYQKMVDEQTLKLKFERASWRKAVTFAWSRIPDPLARRELKMIATK
GRSSLTDDKFNEIHRLIAEMKEIYVKARVCSYKQIDGECNLSLDYDLNKIMATSKDYDEL
LHYWHAWHEIIGPQLQNKYLRYVQLANRAAKLNGFADAGDQMRELFEDEYFQQNMAEIMS
AVTPLYKNLFTYVRSKLIERYGDRIHEDGPLPAHVLGDMWSQNWEGLFELVQPFPASRKL
DVTLDMMIQGITPIRMFQIAEEFFTSLGMKPMPPEFWKFSILEKPIDREIKCTPSTWDFC
NRIDYRIKQCTRVTMEDLLSTHYEMAHLQYYLQYKDHPLLFRNEAIPGFHEAVSDAIGLS
IFTRQHLHKIGLHNNLTDDYDSSINFLMLMALRKVAYMPFAYIVDRWRWRVFSDGVEDMT
AHWWELKLQYQGIVPPVPRFERNFDPAAKYHIPADSPYAKYFVSTVLQFQLFQSLCEISG
HTGELHTCDLYRSREAGRLLSDILSMGASRPWQNVVRHMTRSRMNRIDAGAMLKYFEPLN
AWLKRQNEMQPVIGWITSRDDRELFAQWYENSARRIELWNLFPLLLVTAKIIIYINNYIL
HPVI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatagcccaatggaattttgcgacaaacgttactgatgcaaactatcagaaaatggta
gacgaacaaacattaaaattaaaatttgaaagagcttcttggcggaaagcagttactttt
gcttggagtcgaataccagatcctttggcaagaagggaacttaaaatgatcgctacgaaa
ggtcgaagttccctgactgatgataaatttaatgagatacatcgtttgatagcagagatg
aaagagatttatgttaaagccagagtatgttcgtacaaacaaattgatggcgaatgtaat
ttgagtttagattacgatctaaataaaataatggcaacatcaaaagattacgacgaatta
ttgcattattggcatgcttggcatgaaataattggtccacaattacaaaataaatacttg
agatatgttcaattggcaaatcgagcagctaaattgaatggttttgctgatgctggcgat
cagatgagagagttatttgaagatgaatatttccagcaaaatatggcggagataatgtca
gccgtaactccactctataaaaatctttttacttatgtgcgatcaaaactaattgaaaga
tacggtgatagaatacatgaggacggacctttaccggcacatgttttaggagatatgtgg
tctcaaaattgggaaggtttgttcgagttagtgcaaccatttcctgcaagtcgaaagctc
gatgtaactttggatatgatgattcaaggtattactccaataaggatgtttcaaatagcg
gaagaattttttacttcgctcggaatgaaaccgatgccaccggaattctggaaattttcc
atattagaaaaacctattgatagagaaattaagtgcactcctagtacgtgggatttttgt
aatagaattgattacaggataaaacagtgtactagagtcacaatggaagatttattatct
acccattatgaaatggcccatttgcaatattatttacaatacaaggatcatccattgcta
ttccgaaacgaagcaattccaggatttcatgaagctgttagtgatgccattggtttatcc
atttttactcgtcaacatttacataaaattgggctgcacaataatttaacagacgattat
gatagcagcataaattttctgatgttaatggcacttcgcaaagtggcttatatgccgttt
gcttatatagttgatcggtggagatggcgtgtatttagtgacggcgtcgaagatatgaca
gcgcattggtgggaattaaaattgcaatatcaaggcattgttccacctgtacccagattt
gaaagaaattttgatccagcagcgaaatatcatatcccagcagatagtccttatgccaag
tattttgtaagtactgtattacagtttcaactgttccaatctttgtgtgaaatttctggt
catactggcgaattgcacacttgcgatctttatagatcacgagaagcaggtcgattacta
tcagatattctgtcaatgggagcttctagaccgtggcaaaacgttgttagacatatgaca
agaagcaggatgaatagaatagatgctggtgccatgctcaaatattttgagcctttaaat
gcatggttaaaacgacaaaatgagatgcaacctgtgatcggctggatcacaagtcgcgat
gacagagaattattcgcacaatggtacgaaaacagtgcacgaagaattgaattgtggaat
ttatttcctctactgcttgtaactgctaaaattattatttatattaataattatatatta
catccagtgatttaa

DBGET integrated database retrieval system