KEGG   Atta cephalotes (leaf cutting ant): 105621918Help
Entry
105621918         CDS       T04923                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:acep00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    105621918
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    105621918
Enzymes [BR:acep01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105621918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MTIKAVCVLQGEPVKGTVYFEQTEDSNTVKVSGQVSGLQKGLHGFHVHEFGDNTNGCTSA
GAHFNPLGKDHGGPNDSVRHVGDLGNVEAGTDGVAKVNITDAMIQLSGAHSVIGRTLVVH
ADPDDLGQGGHELSKTTGNAGARLACGVIGITK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaaggcggtctgtgtcctgcagggagaacctgttaaagggaccgtgtatttt
gaacaaacggaagattcaaatacggtcaaggtatctggacaagtttccggcttgcagaaa
ggcctgcatggttttcacgttcatgaatttggcgacaacaccaatggttgcacgagtgca
ggcgctcatttcaatccgctaggaaaagatcatggtggtccaaatgacagtgtacgtcat
gttggagatttaggaaacgtggaagctggtactgatggtgttgcaaaagttaatatcacc
gatgctatgattcaactcagtggagcgcatagtgtcatcggacgaactcttgtggttcat
gctgatcctgatgatttgggccagggtggtcatgagttatcaaaaactactggcaatgct
ggtgctcgtcttgcttgcggtgttattggcatcacaaagtaa

DBGET integrated database retrieval system