KEGG   Atta cephalotes (leaf cutting ant): 105625196Help
Entry
105625196         CDS       T04923                                 

Definition
(RefSeq) glutathione S-transferase 1-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00480  Glutathione metabolism
acep00980  Metabolism of xenobiotics by cytochrome P450
acep00982  Drug metabolism - cytochrome P450
acep00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:acep00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    105625196
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105625196
   00982 Drug metabolism - cytochrome P450
    105625196
   00983 Drug metabolism - other enzymes
    105625196
Enzymes [BR:acep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105625196
Transporters [BR:acep02000]
 Other Transporters
  Pores ion channels [TC:1]
   105625196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 105625196
NCBI-ProteinID: XP_012061926
UniProt: A0A158NWL8
LinkDB All DBs
Position
Unknown
AA seq 217 aa AA seqDB search
MPIDLYQLTGSPPCRAVLLTAAAVGVDLNMKNVDLSAGEHLKPEFIKMNPQHTVPTLDDD
GLYLCESRAIMTYLVNQYGKNDSLYPNDPKKRAMVDQKLYFDMGTLYRSFADYYYPIIFT
DITPEQAKYDKLHEALSLLDKFLEGENYVAGKTLTLADITLVVSVSNFPLVDYDLSKYSN
ILKWFIKIQAEIPNYSELESVGMKAFADFVEHYKKKT
NT seq 650 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgatctttaccaactcaccggaagtccgccatgtcgggccgttctcttaacg
gcggcagctgtaggagttgatttaaatatgaaaaacgtagatctctctgccggcgaacat
ctaaaacccgaatttattaagatgaacccacaacatacagtacctacattggatgatgat
ggcttatatttatgtgaaagccgcgcaattatgacttatctagtcaatcaatatggcaag
aacgattctctgtatccaaatgatccgaaaaaacgagctatggtggatcaaaaactttac
ttcgatatgggaactctgtatcgatcgtttgctgattattattatccaataatattcacc
gacatcactccggagcaagcaaaatatgataaactgcacgaagccttgtctctcttggat
aaattcctagaaggggaaaattatgtagcaggaaaaactctaactctcgctgatattacc
ttggtcgtctccgtttctaattttccgcttgtagattatgacttgagtaaatatagcaac
attctgaaatggtttattaagatccaagctgaaattcctaattacagtgaactcgaaagc
gttggtatgaaggcatttgcagacttcgtcgaacactataaaaaaaagac

DBGET integrated database retrieval system