KEGG   Atta cephalotes (leaf cutting ant): 105626741Help
Entry
105626741         CDS       T04923                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    105626741
   04614 Renin-angiotensin system
    105626741
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    105626741
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    105626741
Enzymes [BR:acep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105626741
Peptidases [BR:acep01002]
 Metallo Peptidases
  Family M2
   105626741
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105626741
CD molecules [BR:acep04090]
 Proteins
  105626741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 689 aa AA seqDB search
MKFAFSGTGGMLDRVSSSFIRWTVLLLCLLSAVSGQLDLPPYRDEDATRQLPPNEINYQN
ILARLDFLGAERCSANVIAQWAYETNVNEYTQLQALDAQRLYADFQYQAWLLLSRIDINS
IRDPIIRRRLRYLSVVGPSALPPDQLDRYNRLINDMLAIYNAATICAYNDPFRCGLRLYP
DISQIMAKSRDWDELQYVWTEWRRRSGRPIRDLYHQLIALTNDAARMNNFTDAAEYWMFP
YESPNFQQDIDEVWETIRPLYEELHAYIRRRLRDLYGPEKIGVHTPLPSHILGNIWGQSW
TNLLDVTLPYPGKTYPDVTQEMRTQGYTPIDMIRVAEEFYLSLNLSAMPPEFWAGSVIAD
PGDRPLICQASAWDFCNRIDYRIKMCTKVTMKDLITLHHEMAHIQYFLRYSGLPREFRDG
ANPGFHEAVGEVIALSVTTPQHLQTLGLANTFIDERSADINYLFALAMDKLVLLPFSIAM
DRWRWDVFRGYVNKEEYNCHWHRLKEQYTGTKPPVLRSEDDFDPGAKYHIPANIPYIRNF
VAGVLQFQLYRALCQVAGQRSEIDNPRRPLHRCDFYRKPEAGKILGRLMERGSSIPWRDT
LGEAIGEFRLDGSALREYFRPLEDWLRTENLRTGEVVGWSYDGDFCKRSIETAGLQVYGS
GFYNSGTSISASWIVTGIVMILWFVSTLY
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgccttcagtggaaccggcgggatgttggaccgcgttagcagcagcttcata
agatggacagtccttttactctgtctattatcggcagtttccggtcaattggacttaccg
ccctacagagacgaagatgctacccgacaactaccacccaatgaaataaattaccagaac
atcctagctagattagatttcctaggtgcagagagatgtagcgctaatgtgatagctcaa
tgggcatacgaaactaatgtcaacgaatacacgcagctgcaagcgctggatgcccaacgc
ttatatgcggatttccaataccaagcatggcttttactctcgagaatcgacataaattct
attcgagaccccatcatcaggcgacgactccgttatttgtccgtggtgggtccttcagca
cttccacctgatcaactagacaggtataatcgcttaatcaatgacatgcttgcgatttat
aacgcagcgaccatatgcgcttacaacgatccgttccggtgtggactgcgtttatatcca
gatatatcgcaaatcatggcgaaaagtcgggactgggacgaattgcagtacgtctggacc
gaatggagaagacgaagtggcagaccgattagggatctatatcatcaacttattgcgctg
accaatgacgctgcaagaatgaataattttactgatgccgccgaatattggatgttccct
tacgaatctcctaattttcaacaagacattgatgaagtttgggaaacgatacgtccactt
tatgaagaactacacgcttatattcgtagaaggctaagagatctctacggtcctgaaaaa
attggcgtacacacacctcttccgtctcatattctcggtaacatatggggacagtcttgg
actaatcttttggatgttacattgccatatcccggtaaaacgtatcccgacgtcacgcag
gaaatgcggactcaagggtacactcctattgacatgattcgggtggccgaggaattctat
ctgtccttaaatttgagcgcaatgccgccggaattctgggccggaagcgtaatcgccgat
cctggcgaccgtccattaatttgtcaagcgtctgcatgggatttttgtaatcgcatagat
tacagaatcaaaatgtgtacaaaagtgacgatgaaggatttgataactttgcatcacgaa
atggcacacattcagtatttcttgaggtacagtggactacctcgagaatttcgtgacggc
gctaatccaggattccacgaggcggtcggtgaagtcatcgccttaagcgtcacgacgccg
cagcatctgcaaactctgggcttagcgaacacgttcattgatgaacgctccgcggacata
aactatctcttcgccttggcgatggataaattggtgctgctgcccttcagcatcgcgatg
gataggtggcgatgggatgtcttccgtggctacgtcaataaagaggagtataattgtcat
tggcacagactgaaggaacaatacacgggaacaaagccaccagttctgcgatccgaggat
gatttcgatccaggagcgaagtatcacattccagccaatattccctacatacggaatttc
gtggctggggtcctgcaattccaattgtatcgcgcactatgccaggttgcaggtcaaaga
tccgaaatcgacaatccgaggaggccgctgcacagatgtgacttttacagaaaacccgag
gccggcaagatcttggggagattgatggagaggggttcgtccattccatggcgagataca
ctgggagaagctatcggcgagttcagattagacggatccgctcttagggagtacttccgg
ccattagaggactggttgaggaccgagaatttgaggacgggcgaagtagtcggctggtca
tacgacggagacttttgcaagaggagcatagagaccgcgggtttgcaggtttacggtagc
ggcttctacaatagcggcacatccatctccgcatcttggatcgttacgggaatcgtgatg
attctttggtttgtatcaacactttattga

DBGET integrated database retrieval system