KEGG   Pseudarthrobacter chlorophenolicus: Achl_1787Help
Entry
Achl_1787         CDS       T00834                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
Organism
ach  Pseudarthrobacter chlorophenolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2020578..2021600
Genome map
AA seq 340 aa AA seqDB search
MASEQTTITVPGPHGEREMRISSPSRVLFPDLGLTKLDLARYICEVGEAFIAANGDRPVS
LQRYSDNIDGEMFFSKNPPRGTPDFVRSVKVVYPSARSHPQLVLDEPAAAVWAVQMNTVV
FHPWPSRAENTDNPDQLRIDLDPQPGTDFDDAIPAAQVLRDVLAEAGLESFIKTSGNRGL
HVYAPIEPVREFLDVRHAVIAAAREVERRMPDKVTTAWWKEERGERIFLDFNQANRDRTI
AGAYSPRALPHAPVSCPITWDELETTDPRKFTVLTVPDRLKTVGDPWAGFGEKPGSIGTL
LEWWDRDIRDGLGEMPFPPDYPKMPGEPPRVQPSRAKKQD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgaacagaccaccatcaccgtcccgggcccccatggcgagcgcgagatgcgc
atttccagccccagcagggtcctgttcccggacctgggcctgaccaagctggatctcgcc
cggtatatctgcgaagtaggggaggcattcatcgcagcgaacggggaccgtccggtgtcc
ctgcagcggtactccgacaacatcgacggcgagatgttcttctcgaagaacccgccccgc
ggcaccccggatttcgtccggtccgtcaaggtggtctacccgagcgcgcgttcccatccc
cagctggtgctggacgagccggcagccgcagtctgggccgtgcagatgaacactgtggtg
ttccacccgtggccgtcccgggcggagaacacggacaacccggaccagctccggatcgac
cttgacccgcaacccggtacggatttcgacgacgccataccggcggcccaggtgctgcgg
gatgtcctggccgaggccggactcgagtcgttcattaagacctcaggcaaccgcggcctg
catgtttatgctccgattgaaccggtccgcgaattcctggacgtccggcacgccgttatt
gccgcagcccgcgaggtggaacggcggatgccggacaaggtgaccacggcgtggtggaag
gaggaacgcggtgagcggatcttcctggacttcaaccaggccaaccgcgaccggaccatc
gcgggcgcctacagcccccgggccctgccgcacgccccggtctcctgtcccatcacgtgg
gacgaactggaaaccactgatccccggaagttcaccgtactcaccgtccccgaccggctg
aagaccgttggcgacccctgggcagggttcggggaaaagcccggcagcatcggcacgctg
ctcgagtggtgggacagggatattagggacgggctcggcgagatgccgttcccgccggac
tatccaaagatgcccggcgaaccgccgagggtgcagccgagccgcgcaaagaagcaggac
tga

DBGET integrated database retrieval system