KEGG   Acidovorax sp. P4: CBP36_17035Help
Entry
CBP36_17035       CDS       T04962                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
acip  Acidovorax sp. P4
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acip00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP36_17035
Enzymes [BR:acip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CBP36_17035
Transporters [BR:acip02000]
 Other Transporters
  Pores ion channels [TC:1]
   CBP36_17035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3667171..3667818
Genome map
AA seq 215 aa AA seqDB search
MLTLCGFSASNYYNKVKLALLEKGLPFTEETAWVGETDPSATPLGKVPYLRTPQGTLCES
AVMVDYIEAAHPLPPLLPADPFAAAKVRELITFLELHLELVARNLYPQAFFGGTVSESTR
EKVGTQLEKNIAAFGQLAQFSPYVAGDSFTLADCAAIVHLPLISSATKIIYGRDFLANLP
VREYLTRMGERPHVQRVNADRKASTAEMLARRPKR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctgacactctgcggcttttcagccagcaactactacaacaaggtcaagctcgccctg
ctcgaaaaaggcctgcctttcaccgaagaaacggcctgggtgggcgagaccgaccccagc
gccacgccgctcggaaaggtgccctacctgcgcacgccccagggcacgctgtgcgagtcg
gcggtgatggttgactacatcgaagccgcccatcccctgccacccttgctgccagccgac
ccgtttgccgccgccaaggtgcgcgagctgatcacctttctggaactgcacctggagctg
gtggcgcgcaacctgtacccccaggccttctttggcggcacggtgagcgaatcgacccgc
gagaaggtgggcacgcagctggagaagaacatcgccgccttcggtcagctggcccaattc
agcccctatgtggcgggcgacagcttcaccctggccgactgcgccgccatcgtgcacctg
ccgctcatcagttcggccaccaaaatcatttatggccgcgacttcctggccaacctgccg
gtgcgcgagtacctcacgcgcatgggcgagcgcccccatgtgcagcgcgtgaacgcagac
cgcaaggccagcaccgccgaaatgctggcgcgccgacccaagcgctga

DBGET integrated database retrieval system