KEGG   Acidovorax sp. P3: CBP35_17905Help
Entry
CBP35_17905       CDS       T04998                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acis  Acidovorax sp. P3
Pathway
acis00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acis00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP35_17905
Enzymes [BR:acis01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CBP35_17905
Transporters [BR:acis02000]
 Other Transporters
  Pores ion channels [TC:1]
   CBP35_17905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_C_2 GST_N_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ART56409
LinkDB All DBs
Position
3854373..3854984
Genome map
AA seq 203 aa AA seqDB search
MSAPTLYLAPGTCALAVHIALHEAQAGHELVRLDFAAQQQRSPEYLAINPKGRVPALVTE
HGVLTETPALLAYVAQRYAQGQLAPLDPFAFARMQEFNSYLASTVHVAHAHGRRGSRWAD
DPASHADMLRKVPQTMAECFGVIEDHYLQGPWVLGEQYSVADAYLFTLSGWLRSDGVDVA
QFPKVADHRRRMAERPAVQRALA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacccacgctgtacctcgctcccggcacctgcgccctggccgttcacattgcc
ttgcacgaggcccaggcaggccacgaactggtgcgccttgactttgccgcccagcagcaa
cgcagccccgaatacctggccatcaaccccaagggccgcgtgcctgccttggtgaccgag
cacggcgtgctgaccgaaaccccggcgctgctggcctatgtggcccagcgctacgcccag
gggcagctggcgccactggatccgtttgccttcgcacgcatgcaggagttcaacagctac
ctggcctccaccgtccatgtggcccacgcccacgggcggcgcggcagccgctgggcagac
gatcccgcctcccatgccgacatgctgcgtaaagtcccgcagaccatggcggagtgcttt
ggcgtgatcgaagaccactacctgcaaggcccctgggtgctgggggagcaatattccgtt
gccgatgcctacctgttcaccctgtccggctggctgcgcagtgatggcgtggacgtggcg
cagtttcccaaggtggccgaccaccggcgccgcatggccgagcggcctgccgtccagcgc
gcgctggcctga

DBGET integrated database retrieval system