KEGG   Acidovorax sp. KKS102: C380_11440Help
Entry
C380_11440        CDS       T02290                                 

Definition
(GenBank) RuBisCO-like protein
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C380_11440
Enzymes [BR:ack01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     C380_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2489055..2490332)
Genome map
AA seq 425 aa AA seqDB search
MSPDRFEATYLIETPLDPAHVAEVLAGEQSCGTFTRVEGETDALRERARATVESIELLDV
ALVPSLPNGWMQRRGMFGTPQTWQRARLRVSFPCGNIGPNLPTLAATVSGNLFDLGEVTG
LRLESMKLPRAYREQFDMPRQGIAGTRALTGVQGRPLIGTIIKPNVGLSAEETGELAGRL
CAAGVDFIKDDEVCANPVHAPLADRVKSVMRRVRAHQDKTGKLVMVAFNITDETDAMRRH
ADLIAAEGGSCVMVSLNWCGYSAVQTLRRHTPLALHGHRNGYGALSRHPLLGFSFNAWQT
LWRLAGVDHMHVHGLQGKFSQTDEEVIESAHDTLAPLCEGLDDRVLPAFSNGQWAGTVPA
TWDSVHSNDLLFMSGGGILAHPDGAAAGVASLQQAWDAVQKNETLAERAAHAPELRRAIE
FFGKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtccccagaccgctttgaagccacctatctgatcgaaaccccgctggaccccgcccac
gtggccgaggtactggcgggcgagcaatcgtgtggcaccttcacccgggtggagggcgag
accgatgcgctgcgcgaacgcgcccgcgccacggtcgaatccatcgagctgctggacgtg
gcgctcgtcccctcgctgcccaacggctggatgcagcggcgcggcatgttcggcacgccg
cagacctggcagcgcgcccggctgcgcgtgagctttccgtgcggcaacatcggccccaac
ctgccgacgctggcagccacggtgtcgggcaacctgttcgacctgggcgaggtcaccggt
ttgcgtctggagtcgatgaagctgccccgcgcctaccgcgagcagtttgatatgccccgc
caaggtattgcaggcacacgcgcgctgaccggcgtgcagggccgcccgctcatcggcacc
atcatcaaacccaacgtgggtttatcggccgaagaaaccggtgaactggcgggccgcctg
tgcgccgccggggtggacttcatcaaggatgacgaggtgtgcgccaacccggtgcacgcc
ccgctggccgaccgcgtgaaatccgtgatgcgccgtgtgcgggcccaccaggacaagacc
ggcaagctcgtgatggtggcgttcaacatcaccgatgagaccgacgccatgcgccgccat
gccgacctgattgccgccgagggtggcagttgtgtgatggtcagcctgaactggtgcggc
tactccgccgtgcagacgctgcgccgccacaccccgctggccctgcacggccaccgcaac
ggctacggcgccctgtcgcgccacccgctactgggcttttcgttcaacgcctggcagacg
ctgtggcgcttggcgggtgtggaccacatgcatgtgcacggcctgcagggcaagttctcg
cagaccgatgaggaagtgatcgagtccgcccacgacacactggccccgctgtgcgaagga
ctggatgaccgcgtgctgcccgccttctccaacggccagtgggccggcacggtgcccgcc
acctgggacagtgtgcatagcaacgacctgctgttcatgtccggtggcggcattctggcc
caccccgatggcgcggccgctggcgtggccagcctgcagcaggcttgggacgcggtgcag
aaaaacgaaaccctggcggagcgcgctgcacacgcgccagagctgcgccgggccatcgaa
ttcttcggcaagaagtga

DBGET integrated database retrieval system