KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0418Help
Entry
A2cp1_0418        CDS       T00833                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
472303..474063
Genome map
AA seq 586 aa AA seqDB search
MRLRGPPQPPPRHTTLVHALAAAAAHPSGATFLDLHERETSLPWSEVRARAERAAANLVH
LGIRRGDRVAIVLRTEPAFLDAFFGAWLAGAVPVPLYPPVRLGRLDAYAVDTGRMIQVAG
ARLVVSAGGTRRLLGGAVERGGPELGCVDVSALSALPARIAREPEPDALGLVQFSSGTTV
DPKPVALTHRALAAMTDALVAATSAGPDDVLVSWLPLYHDMGLIGCLLAAMSYPGPLVLI
PPEHFLTRPALWLRALARRRGTISAAPSFAYAYAADRVQDADLAGLSLAPVRLLLDGAEP
VSAVALRRFAERFAPHGLDPRALVPVYGLSEAALAVTFARPGGPLGGLGVDAARLASEGV
VAPGGREVMPVGTPVPGVEVELRTEAGAPVGEGRIGRVFVRGPALMREYLGDPEATARAL
RGGWLDTGDLGFVVDGALHLHGRARDLVIVRGANHAPEEFEAPLAALPGLRPGCAVALGF
EPEGGAGEALLVLAERARDEETPDGELEARVRRAVLAATGIAPHTVRLLAPGTLPRTSSG
KLRRAEALRRFQAGTLTPPQPVSAIRLALAAARSQLAFGRSRRRGG
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctgcgcgggccgccccagccgccgccgcgccacaccacgctggtgcacgcgctg
gcggccgcggccgcgcacccctccggcgcgaccttcctcgacctgcacgagcgcgagacg
tccctgccctggtcggaggtccgcgcccgggccgagcgcgccgccgccaacctcgtccac
ctcggcatccggcgcggcgatcgggtcgccatcgtgctccggaccgagccggccttcctg
gacgcgttcttcggcgcctggctggccggcgcggtgccggtgccgctctacccgccggtg
cggctgggccggctcgacgcgtacgcggtggacaccggccggatgatccaggtggccggg
gcgcgcctggtcgtctccgcgggcggcacgcggcggctgctcggcggcgccgtcgagcgg
ggcgggccggagctcgggtgcgtggacgtgtcggcgctctcggcgctgcccgcccgcatc
gcgcgcgagccggagccggacgcgctcggcctggtgcagttctcctccgggacgacggtg
gacccgaagccggtcgcgctcacccaccgcgcgctcgcggccatgaccgacgcgctggtc
gcggcgacctcggcgggcccggacgacgtgctcgtgtcgtggctgccgctctaccacgac
atgggcctcatcggctgcctgctcgccgcgatgagctacccgggtccgctcgtgctcatc
ccgcccgagcacttcctcacccgccccgcgctctggctgcgcgcgctggcccggcgacgc
ggcaccatctcggccgcgcccagcttcgcgtacgcgtacgcggccgaccgggtgcaggac
gccgacctcgccggcctctcgctcgcgccggtgcggctgctgctcgacggcgccgagccg
gtctcggcggtggcgctgcgccggttcgccgagcgcttcgcgccgcacgggctcgacccg
cgggcgctcgtgcccgtgtacggcctcagcgaggcggcgctggcggtgacgttcgcgcgg
cccggcggaccgctcggcgggctcggcgtcgacgcggcccggctcgcgtcggagggcgtg
gtcgcgcccggcgggcgggaggtgatgccggtcgggaccccggtcccgggcgtcgaggtc
gagctgcgcaccgaggccggggcgccggtgggggaggggcggatcgggcgcgtgttcgtg
cgcggcccggcgctcatgcgcgagtacctgggcgaccccgaggcgaccgcgcgcgcgctc
cggggtggatggctcgacaccggcgacctcggcttcgtggtggacggcgcgctccacctc
cacggccgcgcccgggacctcgtgatcgtgcgcggcgcgaaccacgcgccggaggagttc
gaggcgccgctcgcggcgctccccggcctgcgcccgggctgcgcggtggcgctcggcttc
gagccggagggcggcgccggcgaggcgctgctcgtgctcgcggagcgcgcgcgagacgag
gagaccccggatggcgagctggaggcgcgggtccggcgcgcggtgctggcggcgaccggc
atcgcgccgcacaccgtgcggctgctcgcgcccggcacgctcccgcggacgtcctcgggc
aagctgcggcgcgccgaggcgctgcgccggttccaggcggggacgctcacgccgccgcag
ccggtgagcgcgatccgcctcgccctcgccgccgcccgctcgcagctcgccttcgggcgg
tcgcgtcgccgcgggggctga

DBGET integrated database retrieval system