KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4390Help
Entry
A2cp1_4390        CDS       T00833                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A2cp1_4390
   01230 Biosynthesis of amino acids
    A2cp1_4390
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2cp1_4390
   00620 Pyruvate metabolism
    A2cp1_4390
  Nucleotide metabolism
   00230 Purine metabolism
    A2cp1_4390
Enzymes [BR:acp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     A2cp1_4390
Exosome [BR:acp04147]
 Exosomal proteins
  Proteins found in most exosomes
   A2cp1_4390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4884274..4885743
Genome map
AA seq 489 aa AA seqDB search
MRRAKIVATLGPASGEPDVLARLLEQGVDVARLNFSHGRHEDHARMLDKIRAASRHLGKA
VAVLQDLQGPKIRTGPLKAGKAGVQVEAGQEIVITTEGELAGDAHLVSTTYPHLAEDVRA
GDRLLVDDGLLEFRVLATDGVRVRAEVVEGGWLGEHKGINLPGVALRTEAMSEKDRADVA
FGISHGVDYVALSFVRTPQDIGLCREEMERAGRVVPIIAKIEKPEAIDNLDAIIAAADGV
MVARGDLGVEILPERVPLLQKEICSKANASGKPVIIATQMLNSMMEHPRPTRAEASDVAN
GIWDGADAVMLSGETASGRFPLAAVQMMDRIVREAEAGSPAALHARVPPPARPAPFNLVT
ASAACEAAEAAGAVAICCFTLRGETARLLAHFRPRVPIVAFSPDQSIRRRLALYWGVLPK
VMEPVKNADLMAEIVSDRLLEEKLVKPGDRVVLVHGSPLGLPGQTNSIRLHEITHPSDRG
PTQRYRVPV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccaagatcgtcgccaccctcggacccgcgtccggcgagccggacgtgctc
gccaggctcctcgagcagggggtggacgtcgcccgcctgaacttctcccacggccggcac
gaggaccacgcgcggatgctcgacaagatccgcgccgcctcgcgccacctcggcaaggcc
gtggccgtgctgcaggacctgcagggcccgaagatccgcaccggcccgctgaaggccggg
aaggcgggcgtgcaggtggaggccgggcaggagatcgtcatcaccaccgagggcgagctg
gcgggcgacgcgcacctcgtctccaccacctacccgcacctcgccgaggacgtgcgcgcc
ggcgaccgcctgctggtggacgacggcctgctcgagttccgggtgctcgccaccgacggc
gtgcgcgtgcgggccgaggtggtggagggcggctggctcggcgagcacaaggggatcaac
ctgcccggcgtggcgctccgcaccgaggccatgtccgagaaggaccgggccgacgtggcg
ttcggcatctcccacggcgtggactacgtcgcgctgtcgttcgtgcgcacgccccaggac
atcggcctctgccgcgaggagatggagcgcgccggccgggtggtgcccatcatcgcgaag
atcgagaagcccgaggccatcgacaacctcgacgccatcatcgccgccgccgacggggtg
atggtggcccgcggcgatctcggcgtggagatcctgccggagcgcgtgccgctgctgcag
aaggagatctgctcgaaggcgaacgcctccggcaagccggtcatcatcgccacccagatg
ctgaactcgatgatggagcacccgcgccccacccgcgccgaggcgtccgacgtggcgaac
gggatctgggacggtgccgacgcggtgatgctctccggcgagaccgccagcggccgcttc
ccgctcgcggcggtgcagatgatggaccgcatcgtgcgcgaggcggaggcgggctcgccg
gccgcgctccacgcgcgcgtcccgccgccggcgcgcccggcgccgttcaacctggtgacc
gcgtcggccgcctgcgaggccgccgaggccgccggggcggtcgcgatctgctgcttcacg
ctgcgcggcgagaccgcgcggctgctcgcgcacttccgcccgcgggtgccgatcgtcgcg
ttctcgccggaccagtccatccgccggcgcctggcgctgtactggggcgtgctgccgaag
gtgatggagccggtgaagaacgccgacctcatggccgagatcgtctccgaccggctcctc
gaggagaagctggtgaagccgggcgaccgggtggtgctggtgcacggctcgccgctcggc
ctgcccggccagacgaactccatccgcctgcacgagatcacccacccgtccgatcgcggg
cccacccagcgctaccgcgtcccggtgtag

DBGET integrated database retrieval system