KEGG   Arthrobacter crystallopoietes: AC20117_06685Help
Entry
AC20117_06685     CDS       T05322                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry00250  Alanine, aspartate and glutamate metabolism
acry00410  beta-Alanine metabolism
acry00640  Propanoate metabolism
acry00650  Butanoate metabolism
acry01100  Metabolic pathways
acry01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acry00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AC20117_06685
   00650 Butanoate metabolism
    AC20117_06685
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AC20117_06685
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AC20117_06685
Enzymes [BR:acry01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AC20117_06685
Amino acid related enzymes [BR:acry01007]
 Aminotransferase (transaminase)
  Class III
   AC20117_06685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AUI50561
UniProt: A0A1H1CX97
LinkDB All DBs
Position
1396804..1398081
Genome map
AA seq 425 aa AA seqDB search
MTSLSPALKQATPVVVDHALGSWIHGTDGKDYLDFTTGIGVTSTGHCHPKVVEAAREQVG
KIIHAQYTTVMHKPLLALTEKLGEVLPAGLDSVFYANSGSEAVEAAIRLARMATGRPNIV
VFQGGFHGRTVAAASLTTAGTKFSAGFAPLMAGVHMSAFPYAYRYGWDEATAVAFALQEL
DYLLQTRTAPNDTAAFLIEPALGDGGYLPTPPAFMEGLRERADRHGIQLIFDEVQAGVGR
MGKFWGHQYSTATPDILITAKGIASGFPISAIAASTETMSKAWPGSQGGTYGGNAVSAAA
GVATLEVVEEEGLVENSRIRGEQLQAGLKEIQNRFPVIGNVRGLGLMQGIEFTAEDGTPD
AKTAAAVQQATTTQGLLSLTCGPAGNVVRLIPALVVTADEISTGLERFEAAVGAVVGAVP
AKAGV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactcagccccgcgctcaagcaagcaacccccgtcgtcgtcgaccacgccctc
ggctcgtggatccacggcacggacggcaaggactacctggatttcactaccggcatcgga
gtgaccagcaccggccactgccacccgaaggttgtggaagcggcgcgcgaacaggtcggc
aagatcatccatgcccagtacaccaccgtgatgcacaagccgctgctggcgctgaccgag
aagctcggcgaagtcctccccgcgggactggactccgtgttctacgcaaactccggctcc
gaggccgtcgaggccgccatccgcctggcccgcatggccaccggccggcccaacatcgtc
gtgttccagggcggcttccacggacgcaccgtcgccgccgcctccctgaccacggccggc
accaagttctccgccggcttcgcgccgctgatggccggcgtccacatgtccgccttcccc
tatgcctaccgctacggctgggacgaagccaccgccgtcgccttcgcgctgcaggagctg
gactacctgctgcagacccgcaccgcccccaatgacaccgccgcgttcctgatcgaaccg
gcactgggcgacggcgggtacctgcccactcccccggccttcatggagggcctgcgcgag
cgcgccgaccggcacggcatccagctgatcttcgacgaggtgcaggcgggcgtgggccgg
atgggcaagttctggggccaccagtactccaccgccaccccggacatcctcattaccgcc
aagggcatcgcctcgggcttccccatctccgccatcgcggcttccaccgagaccatgtcc
aaggcctggcccggctcgcagggcggcacctacggcggcaacgccgtttccgccgcggcc
ggtgtggccacgctcgaagtggtcgaagaggaaggcctggtggagaactcccgcatccgc
ggcgagcagctgcaggccggcctgaaggagatccagaaccgcttcccggtgatcggcaac
gtccgcggcctgggcctgatgcagggcatcgagttcaccgccgaagacggcacccccgac
gccaagaccgccgccgcggtccagcaggccaccaccacgcagggcctgctgtccctgacc
tgcggcccggccggcaacgttgtccggctgatccccgccctggtggtcaccgccgacgaa
atcagcaccggactggaacgtttcgaggccgccgttggcgccgtcgtcggtgccgttccc
gccaaagcgggagtctaa

DBGET integrated database retrieval system