KEGG   Anolis carolinensis (green anole): 100552443Help
Entry
100552443         CDS       T01608                                 

Gene name
setdb2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100552443 (setdb2)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100552443 (setdb2)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100552443 (setdb2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100552443 (setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 1049 aa AA seqDB search
MEVDAKLFWSHLDSNTVDLMFERLQRVLLSLQQKIKDGTATEEECCQAFAFIQQVDMTDI
LPLTNVNVASDEDIQNCELDLHSSPSSGVREDPGNVFSFGRMETNEVLSSRSKRMLTGKA
SKVPYQAHTCSKNCLAKRPWNSYKGENPLCLPLLCHFQRRHAKPDAVFKSHDVMYRAPCG
KTLRNFQDVQKYLFQTECNFLFLDHFSFNTYVQVFRNTPSHQSCEFDFDISKGVETVPVS
FCNDIDHSQLPYFKYRKTSWPHGYFLNNFSSTFLDSCSCTDGCIDRTKCACLRLTERKCH
EVSDSSGKGKFIGYRYKRLDEPVPSGIYECSLLCTCDKSMCQNRLVQHGLQERLQVFNTE
KKGWGVRCLDDIDKGTFVCTYSGRLMNRNESWQVKDGDGDDDKEEDAENSNGSNNLLSIK
IEAVCSDSQTELNQTGMQKYLHVKPEDQPDIIQNSSYKKRWHNQTVKRPETRTSILQRHR
RQLGIADASSDEDVSAECQKPVRRGVTATTPKGHENLHLEVGELVNPVQPKVNTDHHAGN
PLSIAALNSTPPVQDEKQCRDLLWTGNACTEELGRGKWESFQNEEAMEDDESQLKAKEVP
YLLDATREGNVGRFLNHSCSPNLFVQSVFVETHNRNFPWVAFFTNRHVKAGTELTWDYGY
EAGSMPEIETPCYCKALKCRKKILLPTLGFYESGCYLHHQKGCWGSTGSNSGGEERGDVR
RRSLLLPRMRGKPADVISPARRSLAAVELLLSRKTTLIMAKMVRRRCAFCPEDEECAIMY
VAEGQDLAVHQDCLLYSSGFVESEEYSSDNLDIRFKVASVVNEIKRGRRLMCYFCRKKGA
TVGCEIKHCRRGYHYFCALCDDAAIETDDVKGTYRSALRVFCPNHDPAKKNSFYDEDSKR
GRSPVPMKSSSTRQKMNNKETVVEENLQALRKRQNQHKGKIEFLRKCKQAGLLDEIFEEM
LDTLHLAQEKLMDDNTSETEYEDTVMSLFDCGLFENILTAAQSGTEEKIQELLNTRKRLD
AQIGILQDLKEVVLSSPGDTISISNSTSE
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgatgcaaaactattctggagtcatttggatagcaacacggtggatttgatg
tttgaacgactgcaaagagtgctgttgtctctgcagcagaaaatcaaggatggaactgca
accgaggaagaatgctgccaagcttttgcatttatacaacaagtggatatgactgacatc
ttacctctgacaaatgtaaatgttgcttctgatgaagatattcagaattgcgaacttgat
ttgcattcttctccctcaagtggagttagagaagatcctggaaatgttttttcttttgga
agaatggagacaaatgaagtgttgtcttcaaggagtaaaagaatgctaaccggaaaggcg
tcaaaggttccatatcaagctcatacctgctcaaaaaattgtcttgccaaaaggccatgg
aactcatataagggcgagaaccctctttgcctgccactgctgtgtcatttccagaggagg
cacgcaaaacccgatgctgtcttcaagtcgcatgatgtgatgtacagagctccttgtgga
aagactctgagaaatttccaagatgtgcagaaatatttgtttcaaacagaatgcaacttt
ttatttttagatcacttttccttcaatacctatgtgcaggtgtttagaaacacacctagt
catcaatcgtgtgaatttgattttgatatcagtaaaggtgttgagacggtaccagtttct
ttctgtaatgatatagaccacagtcagctgccttattttaaatatcggaagacttcatgg
ccacatggatacttcctgaacaatttctccagcactttccttgactcatgcagctgcacc
gatggctgcatcgacaggacaaaatgtgcctgcctgcgtcttactgagagaaagtgccat
gaagtgtcagattcttcaggaaagggaaaattcattggctatcgttacaaaaggctggat
gaaccagttcctagcggaatttacgagtgcagcttgttgtgtacctgtgacaagagcatg
tgccagaacagattagtgcagcatggtcttcaagagcggctccaggttttcaacaccgaa
aagaagggctggggggtccgttgccttgatgatattgacaaagggacgtttgtttgtacg
tactcaggcagactgatgaacagaaatgaatcttggcaagtaaaggatggtgatggagat
gatgataaagaggaggatgcagagaatagtaacgggagcaacaacttactttcaattaaa
atagaagctgtctgttctgattcacagactgaacttaaccaaactgggatgcaaaaatat
ttgcatgtaaaacctgaagatcagccagatataattcagaactccagctacaaaaagcgt
tggcataaccaaactgtcaaaaggccagaaaccagaacatctattcttcagcgtcaccgg
agacaactaggtattgctgatgccagctcagatgaagatgtgagtgctgagtgccagaaa
ccagtaaggagaggagtgactgctacaaccccaaaaggacatgaaaatctacatttagag
gtcggagaacttgtgaatcctgtacagcccaaagttaatacagaccaccatgcagggaat
cctctttccattgctgctttgaacagcacaccacctgtgcaggatgaaaagcaatgcaga
gacttactttggactggtaatgcatgcacagaagagcttgggaggggcaaatgggaatct
tttcaaaatgaggaagcaatggaagatgatgaatcacagctaaaggccaaggaggttcct
tatttgctggatgccactagagaaggcaatgtgggccgatttcttaatcacagctgctcc
ccaaatctctttgtacagagtgtatttgtagagacccacaacagaaatttcccatgggtg
gctttcttcacaaacaggcatgtaaaagctggaactgaactcacatgggattatggttat
gaagctggaagtatgcccgaaatagaaacaccctgttactgcaaggctctgaagtgcagg
aaaaaaatactacttccaactctaggattttatgagtctggctgctatttgcatcaccaa
aagggatgctggggctccactgggagcaattctggtggggaggagcgtggtgacgtcaga
cgcaggtcccttctcctgccgcgcatgcgtggtaaacccgcggacgtcattagtccggcg
cgaagatccctggctgccgttgagcttctgctttccaggaaaacgaccttgataatggca
aagatggtaagaagacgatgtgcattttgccctgaagatgaggaatgtgccattatgtat
gttgctgaaggacaggatcttgcagtccatcaggattgtctgttgtattcctcaggattt
gtagagtctgaagaatacagttcggacaatcttgatatacggttcaaggtggcttcagta
gtgaatgaaataaagagagggaggaggctgatgtgctatttctgtcgcaagaaaggagcc
acagttggctgtgagataaaacactgtcgcagaggctatcattatttctgtgcactgtgt
gatgatgcggcaatagaaacagatgacgtgaaaggcacttaccgttctgcattaagagtg
ttttgtccaaatcatgaccctgccaagaaaaacagtttttatgatgaagatagtaagagg
ggaaggtccccagtccccatgaaatcttcatcgactagacaaaaaatgaataataaagag
acggttgtagaagaaaacctacaagccctcaggaaaaggcagaaccaacataaaggaaag
atagaatttttaagaaagtgtaagcaggctgggcttcttgatgaaatatttgaggaaatg
ttagacacacttcatctggcgcaggaaaagctaatggatgacaacacttcagaaacagaa
tatgaagacaccgtaatgtcactttttgattgtggcctctttgaaaacatacttacagct
gctcagtcaggaacagaagaaaaaattcaggagctactaaatacaagaaagagattggat
gcccagattgggattcttcaagatttgaaagaagtagtactttcttctccgggagacaca
atcagcatatctaacagtacctctgaataa

DBGET integrated database retrieval system