KEGG   Anolis carolinensis (green anole): 100553817Help
Entry
100553817         CDS       T01608                                 

Gene name
kmt5b, suv420h1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100553817 (kmt5b)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100553817 (kmt5b)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100553817 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
1
AA seq 861 aa AA seqDB search
MKWLGESKNMVVNGRRNGSRLSNEHHQNQSKLQHPGKENPKTGRNGVERRSSRCSGGSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIER
FKKDEHLEKAFKSLTAGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRY
SSEQNGAKIVATKEWKRNDKIELLVGCIAELSELEENMLLRHGENDFSVMYSTRKNCAQL
WLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYT
CERRGTGAFKSRVGLPVPAPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDAD
TTQEKVHATTRKSSMGVKKNSKSRTLTRQSISRIPTSSNSTSSKLTHLNNSRVPKRLKKP
AKPLLSKIKLRNQCKRPEQRNASRKLEVGNLVLKEPKIVLYKNLPIKKEKDTEGPAKVAI
SSGCLTRHAAREYKLNSGKGAHEPGEVSPCTYITRRSLRTRMNLKETSDSKLEPNMLNSY
KNSLIGMRTNGLEQQSCVMQENEQALVTSHNKGEGKCPKNDRVAAKKKSRQGRLVKTSMK
MEETDPVHNLPSNDTMPDLISSHSDLGEINNVVDSAIGYNDCIPVSGGCSIVTSDTFKVK
NRFRTAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSNSKTNDQENDGMNTSKISIK
LSKDHENDNNLYVAKLNNGFNSGSSSSSTKLKIQLKREEENRGTYSGDLHENGVCCNESL
SLLESRVEVDDYSQYEEETVDDSSSAEEEEEEEDDEYEDDFEDDFIPLPPAKRLRLIVGK
DSIDIDISSRRREDQSLRLNA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtagtgaatggccggagaaatggaagcagg
ttatctaatgagcaccatcagaatcagtctaaattacagcatcctggaaaagaaaatcca
aagactggcagaaatggagttgagagacggtcaagcagatgtagtggtggttcgggattt
gagggccaaagtcgctacgtgccttcctctggaatgtctgccaaggagctgtgtgaaaat
gatgacctagcaactagtttggttcttgatccatatttaggttttcaaacacataaaatg
aacactaggtttcggccaatcaagggaaggcaagaagaactgaaggaggtaattgaacgt
tttaaaaaagatgagcacttggaaaaggccttcaagtccttgacggcaggtgactgggcc
cggcactattttcttaacaagaacaaaatgcaggaaaggttgttcaaggaacatgtattt
atttatttgcgaatgtttgcaactgatagtggatttgaaatattaccatgcaatcgatac
tcatcagagcaaaatggagccaaaattgttgcaacaaaggagtggaaacgtaatgacaaa
atagagttgctggttggatgcattgctgaactctctgaactagaagagaacatgctactc
agacatggagagaatgactttagtgtcatgtattcaacccgaaaaaactgtgctcagcta
tggcttggtccagctgcattcatcaaccatgattgcagacccaactgtaagttcgtgtca
actggtcgggatacagcatgtgtaaaagctctacgagatattgaacctggagaagaaatt
tcttgttactatggggatgggttttttggagaaaacaatgaattctgtgaatgctacaca
tgtgaaagacgtggaactggtgcttttaaatcaagagtggggcttcctgttcctgctcct
gtgatcaatagcaaatatggacttagagaaacagacaagcgtttaaacaggctgaaaaaa
ttgggtgacagcagcaaaaactcagatagccagtctgtaagctccaacactgatgcagat
accactcaggaaaaagttcatgcaactacacgcaaatcttcaatgggtgtaaaaaagaac
agcaaaagtagaacattaacaaggcagtctatttcaagaattccaacttcatcaaattct
acctcatcaaaactaactcatctaaataattccagggtaccaaagagactgaaaaagcct
gcaaagcctttactttcaaagataaagttgcggaaccagtgcaaaaggccagagcagaga
aatgcatccaggaaactcgaagtgggaaacttggttctgaaagagcccaaaatagtcctg
tataaaaacttgcccattaagaaggaaaaagatacagagggaccagcaaaagtggccatc
tctagtggttgcttaactagacatgcagcacgagaatacaaactaaattcggggaaaggt
gctcatgaacctggggaggtatcaccctgtacatatataacaaggaggtcattgagaaca
cgaatgaatctaaaggagacctctgactcaaagcttgaaccaaatatgctgaatagctat
aaaaacagtttgattggcatgcgaactaatggcttggagcaacagtcttgtgtgatgcag
gaaaatgagcaggctcttgttacatcacataacaagggggagggtaagtgtccgaagaac
gacagggttgcggccaaaaagaaatctcgacaagggagactagtgaagacatctatgaaa
atggaggaaactgatcctgtacataacttacctagcaatgacaccatgccagatttgatc
agttcccattctgacctaggagagattaacaatgttgtggattcagccattggctataac
gactgcatccctgtgtcgggtggctgttccattgtaacttcagacactttcaaagtaaag
aatcgctttagaactgcaaaaagcaaaaagaaaaggcgaatcacaaggtatgatgcacag
ttaattcttgaaaacagctctgggatccccaaactgactctgcgaaggcggcatgatagc
aacagcaagacaaatgaccaagaaaatgatggaatgaatacttcaaaaataagcatcaag
ctaagtaaagaccatgaaaatgacaataacttatatgtagcaaagcttaataatggattt
aactcaggatcaagtagtagttcaacaaaattaaaaatacagctaaaacgagaagaagaa
aacagggggacatactctggtgacctccatgagaatggggtgtgttgcaatgaatctctg
tctctgttggagtcacgagtggaagtggatgattatagccagtatgaagaagaaactgtg
gatgattcttcatctgcagaggaggaggaggaggaggaagatgatgaatatgaggatgat
tttgaagatgattttattcctcttcctccagctaagcgattaaggcttatagttggcaaa
gattcaatagacattgatatttcttccaggaggagagaagatcagtctttaaggctcaat
gcataa

DBGET integrated database retrieval system