KEGG   Anolis carolinensis (green anole): 100558072Help
Entry
100558072         CDS       T01608                                 

Gene name
cdc23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100558072 (cdc23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100558072 (cdc23)
   04114 Oocyte meiosis
    100558072 (cdc23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100558072 (cdc23)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100558072 (cdc23)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100558072 (cdc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
2
AA seq 593 aa AA seqDB search
MAAASVAAVTVAAGAGLASADFSDLRTIKKQLLDVAERSRERGLQHSGKWASELAFALDP
LPLNELPPAPALTEEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYL
SGEKKKDDETVDSLGPLEKGQVKNEVLRELRVELSKKHKARELDGFGLYLYGVVLRKLDL
VKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLI
EEALQKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFS
NLLYVRGMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRY
LGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRR
AHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESE
QAAQCYIKYIQDIHSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCAFNDTRE
EGKALLRQILQLRNQGETSSTEIATPFLLPSSLSANNTPTRRVSPLNLSNITP
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgagcgtggcggcggtaacggtggcggccggggccggcttggcgagtgcg
gacttctccgacctgcggaccatcaagaagcagctgctggacgtggcagagcggagccgg
gagcgcggcctgcagcacagcgggaaatgggcctcggagctggcatttgccctggaccct
ctgcccttgaatgagctgccgcctgcgcctgcactcacagaggaagatgctcgtgactta
gacgcctacacacttgctaaatcttactttgatctcaaagaatatgatagggctgcttac
tttctccggggctgcaagagccagaaggcctacttcttatatatgtattctagatacctg
tcaggtgaaaagaagaaggatgacgagacagtggatagtctgggtcccttagagaaggga
caggtgaaaaatgaagttttgagggagttacgggtagagcttagcaagaaacataaagcc
cgagagctggatggattcggcctttatctgtacggggttgtattacgaaagcttgaccta
gtgaaggaggccattgatgtctttgtggaagctacccatgttttgcccttgcattggggg
gcttggctggagctgtgcaacttgattacagacaaagaaatgctgaagttcctgtccttg
ccagatacctggatgaaggagttctttttggcacacatctacacagaactgcagctgata
gaggaagccttgcagaagtatcagagccttattgatgcaggattctccaaaagcacctac
attatctcccagattgcagtggcttatcacaatatcagagatattgataaagcgttgtcc
atcttcaatgaactacgaaaacaagatccttataggatagaaaatatggacaccttttct
aatctgctgtatgttaggggaatgaagcctgagttgagctatctggcccacaacctgtgt
gagattgacaagtaccgtgttgagacctgctgtgtgattggaaattactatagtttacgt
tcccaacatgagaaggcagcactttatttccagagggcattaaaactgaatccccgatac
ctgggagcatggactctcatggggcatgaatacatggagatgaaaaatacatcagcagct
attcaggcatacagacatgccatagaagttaataaaagagactacagagcatggtatgga
ctgggacaaacatatgaaattcttaagatgcctttttattgcctctattactatcgacga
gcccatcagctcagacccaatgattcacgaatgctggttgctcttggagaatgttatgag
aaattaaatcagctagtagaagctaaaaagtgttactggagagcatatgctgttggagat
gtggaaaaaatggcactggtgaaattagcgaagcttcatgaacagttgaatgagtcggag
caagcggctcagtgttatatcaaatacatccaagatatacattcctgtggggagattgtg
gagcatctggaagtgagcactgccttccgctacttggctcagtattatttcaagtgcaaa
ctctgggatgaagcttcagcgtgtgcccagaaatgctgcgcatttaatgataccagagaa
gaagggaaggccctcctgcgacaaatccttcagctaaggaatcaaggagagacatcctct
acagaaattgccacacccttcttacttccatcctcattgtctgccaataatactccaaca
cgccgtgtgtcaccactgaacttgtcaaatattacaccttaa

DBGET integrated database retrieval system