KEGG   Anolis carolinensis (green anole): 100558092Help
Entry
100558092         CDS       T01608                                 

Gene name
ace
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100558092 (ace)
Peptidases [BR:acs01002]
 Metallo Peptidases
  Family M2
   100558092 (ace)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100558092 (ace)
CD molecules [BR:acs04090]
 Proteins
  100558092 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
6
AA seq 1305 aa AA seqDB search
MRSAPLYKPAPSLRPPFRTAKMPQLLALALLLLCCGAALALDASLLPPGSPAATEEGARL
FAQEYNATAETVFFDNTLASWVYNTNLTDFNAQLQVAASLMEQEFIEVWGKKTKEIYGNI
WQNFSDPELKKIISNIQTLGPSNLDLEKRQRYNTIMSEMDNIYSTSKVCLPNQTSNCWAL
EPDITDIMANSRSYSKLLYAWEGWHNSAGNPLRPKYEEFVSLSNEAYKMDGFKDTGAYWR
SSYDSPTFEDDLEELYHQLEPLYLNLHAFVRRKLYDRYGSKYINLKGPIPAHLLGNMWAQ
QWNNIYDMMIPFPNKPNVDVTNTMQQQNWNVTRMFRVSEEFFTSLGMLGMPPEFWEKSML
EKPTDGREVVCHASAWDFYNRKDFRIKQCTTITMEQLFTVHHEMGHVEYYLQYKDQPVTF
REGANPGFHEAIGDVMSLSVSTPAHLKKIGLLSEVTEDKESDINYLLKMALQKIAFIPFG
YLIDQWRWNVFSGRTTPSRYNYDWWYLRTKYQGICPPIARNETNFDPGAKYHIPGNTPYI
RYFVSYIVQFQFHKALCQAANHTGPLHTCDIYQSKEAGRLLSAALRPGSSQPWQDILQQI
TGTNKMDAAPLLEFFSPVISWLEEQNKQTNETLGWPDFEWRPPVPEGYPEGLDKITDEAE
AAKFLEEYNSTAEVVWNTYTEASWTYNVNITEHNKNIMLEKNLELSNHTLHYGLRARTFD
PTDFKDPSIKRILKKLSDIERAALSEQELKEYNQLLSDMETTYSVAKVCTGEKVCKSLDP
DLTKTMAQSRDYDELLEAWKGWRDVSGKKIRTPYKRYVQLSNKAARLNGHADNGAFWRSL
YETPAFEEDLERIWHQLQSLYFNLHAYVRRALYKKYGADHINLKGPIPAHLLGNMWAQSW
ANIFDLVAPFPNAIKVDATPAMKSKGWTPKKMFEESDNFFKSLGLIPMPDEFWKSSMLEK
PKDGREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITTHHEMGHVQYFLQYKDQPISFRD
GANPGFHEAIGDVMALSVSTPKHLFSIKLLDQVEDNPESDINYLMSIALDKIAFLPFGYL
MDQWRWKVFDGRITEDEYNQQWWNLRLKYQGLCPPAPRSEDDFDPGAKFHIPANVPYVRY
FVSFVIQFQFHQALCKAAGHTGPLHKCDIYNSEAAGTILGNALKLGFSKPWPEVMQLITG
QPNMSADALLTYFQPLTDWLINQNLKNQETLGWPEYTWLPYAGQVQADNKVNFLGMLMTS
SEAAAGQWILLVLGLLLLIAAIVLGAKWHQARRRATRSSMEMELK
NT seq 3918 nt NT seq  +upstreamnt  +downstreamnt
atgagatctgcgcctctatataagccggcgccaagtctgcgcccgccttttcggacggcg
aagatgccgcagctgttggcgttggcgctgctgctgctgtgctgcggggcggcgctcgcc
ttggacgcctccctcctgcccccgggcagccccgcggccaccgaggagggcgcccggctc
ttcgcccaggaatacaacgccaccgccgagaccgtcttcttcgacaacacgctcgccagc
tgggtttacaacaccaacctcaccgacttcaacgcccagctgcaggtggcagcttctttg
atggagcaagaattcatagaggtttgggggaaaaaaacaaaagaaatctatggcaacatt
tggcaaaacttcagtgatcctgaactgaagaaaataatcagtaacatccagacattaggc
ccctccaatttggatctggaaaagcggcagcggtataacactataatgagtgagatggac
aacatctattccacttccaaggtgtgtctaccaaaccagacctccaattgctgggctcta
gaaccagatattacagatatcatggcaaattcccgcagttacagcaaactactatatgct
tgggaagggtggcacaattcagctggcaaccccttgaggcccaagtatgaagaatttgtt
tcattaagcaatgaggcctacaagatggatgggttcaaagacactggtgcatattggcgg
tcctcatatgactcaccaacatttgaggatgatctggaagaactctatcatcagttggag
ccactctatctaaacctgcatgctttcgtcaggaggaaactatatgaccgatatggatcc
aaatacatcaacttgaaaggacctattccagctcatttactgggtaacatgtgggcccag
caatggaataatatttatgatatgatgatccctttcccaaataaacctaatgtggacgtc
accaacaccatgcagcaacaaaattggaacgtaacacgcatgttccgggtgtcggaggaa
ttcttcacctcgcttggcatgcttggaatgccacctgaattctgggagaaatccatgctg
gagaagccaacagatgggcgggaggtggtgtgccatgcatcggcatgggacttctacaat
cgcaaagacttcaggataaagcagtgcacaaccatcactatggagcagctcttcacagtc
caccatgaaatgggacatgttgaatactaccttcagtataaggaccaacctgtcacattc
cgggaaggggccaaccctggctttcatgaagccattggggatgttatgagcttatctgtc
tctacccctgcccacctcaagaaaattggtttgctcagtgaagtcactgaagataaagag
agtgatatcaattacctgttgaaaatggccctgcaaaagattgcatttattccctttggc
tacctcatagaccagtggcgatggaacgttttcagtggccgcaccactcccagccgctac
aattatgactggtggtacctgagaacaaagtaccaggggatctgtcctcctattgcaaga
aatgaaacaaactttgatcctggtgctaaatatcacattcctggcaatacaccttatatc
aggtattttgttagttacattgtgcagttccagtttcataaggctctttgccaagctgcc
aaccacaccgggcctcttcatacctgtgatatctaccagtccaaagaagctggaaggctg
ctcagcgcagcattgaggcctggatcttcccagccctggcaggatattcttcaacaaatc
actggcacaaataagatggatgctgcaccactgctggaattttttagccctgttatttcg
tggttggaagagcagaacaagcaaaccaatgaaacgctgggctggccagactttgaatgg
cgtccccctgtcccagagggctacccagaaggacttgataaaataactgatgaagcggag
gctgcaaaattcttggaagagtacaacagcacagctgaagtggtatggaatacttacacc
gaggcctcttggacatacaacgtcaacatcacagaacacaacaaaaatatcatgttagaa
aagaatctagaattgtcaaaccacaccctgcactatggtcttcgggctcggacatttgat
cccactgattttaaagaccccagcataaagcgtattctgaagaaactgagtgatatcgag
cgggcagccctatctgaacaggagctgaaggagtataatcagctcctctcagatatggaa
acaacttacagcgtagccaaagtctgtacaggagagaaagtctgcaagtcacttgatcct
gatcttacaaaaaccatggcccaatcaagggactatgatgaactcctagaagcatggaaa
ggctggcgggatgtatcaggcaagaaaatccggaccccttacaagagatatgtgcaactt
agcaataaggctgccagactaaatggtcatgcagacaatggtgctttctggagatcacta
tatgaaacaccagcttttgaagaagatctagagaggatctggcatcagcttcagtcattg
tacttcaatttacatgcctatgtacgtcgggctctctacaaaaaatatggagcagatcac
atcaatctcaagggccctatcccagctcatttactaggaaacatgtgggcacagtcatgg
gcaaacatttttgaccttgtggcacccttcccaaatgctatcaaagtggatgccacacca
gcaatgaaaagcaagggctggacaccaaagaagatgtttgaagagtcagataattttttt
aaatcactgggcctcatccctatgcctgatgagttctggaaatcatccatgctggaaaaa
ccaaaagatgggagggaagtggtttgccatgcatcagcatgggacttctacaaccgcaag
gatttcagaattaagcaatgcaccgttgtgaatatggatgacttaataacaactcaccat
gaaatggggcatgtccagtactttctgcagtacaaggaccaacccatttcatttcgtgat
ggggccaacccaggatttcatgaagccattggagatgtcatggccctatcggtgtctact
ccaaaacacttattcagcatcaagctgctagatcaggtggaagacaatcctgagagtgac
attaactacttgatgagcattgcattggataagattgctttcctgccctttggctatctg
atggaccaatggagatggaaagtttttgatggccgtattacagaagatgagtacaatcaa
cagtggtggaatttaagactgaaatatcaaggtttatgtccacctgcaccaagatcagaa
gatgattttgacccaggagcaaaattccacattcctgccaatgtcccctatgtcaggtac
ttcgttagttttgttatccagttccagttccaccaagctctttgtaaagctgctggccac
acaggacccttgcacaagtgtgacatctacaactctgaggcagctggaacaatcctgggg
aatgccttgaagctgggcttcagcaaaccatggccagaagtcatgcaacttatcacaggg
caacccaacatgtcggctgatgctttgttgacttatttccaaccactgacagactggctc
atcaaccagaacttgaaaaatcaagaaactctaggctggcctgaatatacctggctaccc
tatgcgggccaagtgcaagcagacaacaaagtcaatttccttgggatgttgatgaccagc
agcgaagccgcagcaggacagtggattttgcttgtccttggactcctccttcttattgca
gcaatagtattgggggccaaatggcaccaggccaggagaagagccaccagatcaagcatg
gaaatggagttgaaataa

DBGET integrated database retrieval system