KEGG   Aspergillus clavatus: ACLA_011330Help
Entry
ACLA_011330       CDS       T01148                                 

Definition
(RefSeq) Cu,Zn superoxide dismutase SOD1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
act  Aspergillus clavatus
Pathway
act04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:act00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    ACLA_011330
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ACLA_011330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 4706706
NCBI-ProteinID: XP_001274132
UniProt: A1CAD8
LinkDB All DBs
AA seq 165 aa AA seqDB search
MVKAGKLGLFHLSCIFAVLRGDSKVSGTVTFEQADENSLTTVSWNITGHDANAKRAFHVH
QFGDNTNGCTSAGPHFNPFGKTHGAPEDAERHVGDLGNFETDAEGNSVGSKKDPLIKLIG
AESVLGRTLVVHAGTDDLGKGESEESKKTGNAGPRPACGVIGIAA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctggtaagttgggactgtttcatctatcctgcatctttgctgtcctccgc
ggtgactccaaggtctccggcactgttaccttcgagcaggccgacgagaactctctcacc
accgtctcctggaacatcaccggccacgacgccaacgctaagcgtgctttccacgtccac
cagttcggtgacaacaccaacggctgcacctccgctggtcctcacttcaaccccttcggc
aagacccacggtgcccccgaggatgctgagcgccacgtcggtgaccttggtaacttcgag
accgatgctgagggtaactccgtcggctccaagaaggaccccctgatcaagctgattggc
gccgagagcgtcctgggccggaccctggtcgttcacgccggtaccgatgaccttggcaag
ggtgagagcgaggagtccaagaagactggcaacgctggtcctcgtcccgcctgtggtgtc
atcggcattgccgcttaa

DBGET integrated database retrieval system