KEGG   Aspergillus clavatus: ACLA_068420Help
Entry
ACLA_068420       CDS       T01148                                 

Definition
(RefSeq) hexokinase Kxk, putative
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
act  Aspergillus clavatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_068420
   00051 Fructose and mannose metabolism
    ACLA_068420
   00052 Galactose metabolism
    ACLA_068420
   00500 Starch and sucrose metabolism
    ACLA_068420
   00520 Amino sugar and nucleotide sugar metabolism
    ACLA_068420
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ACLA_068420
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ACLA_068420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMADVPQNLLQQIKEFEDMFTVDRTKLKQVVDHFVKELEQGLTVEG
GNIPMNVTWVMGFPDGDEQGTFLALDMGGTNLRVCEITLTEEKGAFDICQSKYRMPEELK
TGTAEELWEYIADCLQQFIDFHHEDEELSQLPLGFTFSYPATQDYIDHGVLQRWTKGFDI
DGVEGQDVVPPLEAILQKKGLPIKVAALINDTTGTLIASAYTDPEMKIGCIFGTGVNAAY
MDNVGSVPKLAHMNLPPDMPVAINCEYGAFDNEHIVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALIDLLDSRPGLIFEGQDTSKLRKPYLLDASFLAAIEEDPYENLEET
QELFQRELNIKPTQAELEMIRRLAELIGTRAARLSACGVAAICKKKNIERCHVGADGSVF
TKYPNFKARGAQALREILDWAPNENDKVSILAAEDGSGVGAALIAALTLKRVKAGNLAGI
RNKDEMQKML
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaatcggtcccaagcgtcccccatcccgcaagggatcgatggccgacgtgcca
cagaacctcctgcagcaaatcaaggagttcgaagatatgttcaccgtggaccggaccaag
ctcaagcaggtggttgaccacttcgtcaaggagcttgaacagggcctcactgtggagggt
ggtaacatcccgatgaacgtcacgtgggttatgggattccccgatggagatgaacaagga
actttcctggccctggatatgggaggcaccaacctgcgtgtctgtgagattactctgacc
gaagagaagggtgctttcgatatctgccaatccaagtaccgtatgccggaggaattgaag
accggcactgctgaggagctgtgggagtacatagccgactgtcttcaacagttcattgat
ttccatcatgaagacgaggagctgtcacagttgcccttgggattcaccttctcctaccct
gctacacaggattacatcgatcatggtgttctccagcgctggaccaaggggtttgacatc
gatggcgttgaaggtcaagatgttgttcccccgctggaggcgatcctgcaaaaaaagggg
ctgcccatcaaagtcgctgccttgatcaacgatactaccggaaccctcattgcctcggcc
tacactgatcccgagatgaagattggttgcatcttcggcacaggtgtgaatgcggcttac
atggataatgtcggctcggtgcccaagctggcccacatgaaccttcccccggatatgcct
gtggcgatcaactgcgagtacggtgctttcgacaatgagcatattgttctcccccttacc
aagtatgatcacatcatcgatcgtgattcgcctcgtccgggccaacaggccttcgagaag
atgacggccggtctctacttgggagagatcttccgtctggccctcattgacctcctggac
agcaggccagggctcatcttcgagggtcaggatacctctaagctgcggaagccgtatctg
ctcgacgcctccttcctggctgccatcgaggaggatccttatgagaacttggaggaaacg
caggaactgttccagcgtgagttgaacatcaagcctactcaggcagagcttgagatgatc
cgccgtctggccgagttgatcggtactcgtgctgctcgtctctcagcctgtggtgtcgct
gctatctgcaagaagaagaacattgagcgctgccacgtcggcgccgacggttcggtattc
acgaaataccccaatttcaaggcccgtggtgcccaggcacttcgcgagatcttggattgg
gccccgaacgagaatgataaggtctccattctggcggccgaagatggttccggtgtcggt
gccgccctcattgctgccctgaccctgaagcgtgtcaaggccggtaacctggctggtatc
cgcaacaaggatgagatgcagaaaatgctgtag

DBGET integrated database retrieval system