KEGG   Actinomyces sp. Chiba101: CHIBA101_0636Help
Entry
CHIBA101_0636     CDS       T05279                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
actc  Actinomyces sp. Chiba101
Pathway
actc00473  D-Alanine metabolism
actc01100  Metabolic pathways
actc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:actc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CHIBA101_0636
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CHIBA101_0636
Enzymes [BR:actc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CHIBA101_0636
Peptidoglycan biosynthesis and degradation proteins [BR:actc01011]
 Precursor biosynthesis
  Racemase
   CHIBA101_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAW92502
UniProt: A0A1Q2TLN6
LinkDB All DBs
Position
726483..727916
Genome map
AA seq 477 aa AA seqDB search
MAIETGSPNRSRSPLRPVSAKGGVGEWENPGVSATTTSTEQPIPATTSRAIIDLGAISHN
AAVLARAAGAPWMAVVKADAYGHGLEPVARACLDTGATWLGVAQLAEALHLRSLLDAAGI
ARPVPELRSLPTPDAPRILTWLAPVLTPEGAAAPGSPLRAAIAADLDLSVSALDQARAIA
AAADAEGRAARVHIKADTGMSRAGATDGELPALAAALAGAESAGSLAVVGLWSHLSRADE
PDSGSTEDHLARFRAADDAVTAAGLAPVVRHLAATGGLLWHPDARLDLVRAGIGLYGLSP
DPSVASSAALGLRPAMRLEAPLTLVKRIPAGQAVSYGGTWTAPTSRWVGLVPLGYADGIP
RSASGAPVTVLPSPPSAAPGADDGAVPIHARIVGRVCMDQMVIDLGPAAPAGGPAGEEPP
ARAGDTAVLWGDGADPAGIPTADEWAAACGTINYEIVTRLGARVPRVHLGVGWEDRV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtggcgatcgagaccggttctccgaaccggtctcgatcgccacttcgaccggtctcggcg
aaaggtggggtgggggagtgggagaatcccggcgtgagcgcgaccaccacttccaccgag
cagccgatccccgccaccacctcccgggccatcatcgacctcggcgccatctcccacaac
gccgctgtcctcgcccgggcggccggcgcgccctggatggccgtcgtcaaggccgacgcc
tacgggcacggcctggagcccgtcgcgcgcgcctgcctggacaccggcgccacctggctc
ggcgtcgcccagctcgccgaggccctccatctgcgctccctcctcgacgccgccggtatc
gcgcgccccgtccctgagctccgctcactgccgacgccggacgcgccgcgcatcctcacc
tggctcgccccggtcctcacccccgagggcgccgccgccccggggtcccccctgcgcgca
gcgatcgccgccgacctcgatttgtccgtgtccgccctcgaccaggcccgcgccatcgcg
gccgcggccgatgccgaggggcgcgccgcccgtgtccacatcaaggccgataccggcatg
tcccgcgccggtgcgaccgacggcgagctccccgccctcgccgccgctctcgcgggggcc
gagagcgccgggagcctcgccgtcgtcggcctgtggtcccatctctcgcgcgccgacgag
cccgactccggctccaccgaggaccacctggcccgcttccgcgccgccgacgacgccgtc
accgcggcgggtctcgcgccggtcgtccgccacctcgcggccactggcgggctgctctgg
caccccgacgcgcgcctcgacctcgtgcgcgcgggcatcgggctctacgggctctcgcca
gacccctccgtcgccagcagcgccgcgctcgggttgcgccccgccatgcgcctggaagcc
cctctcacgctcgtcaagcgcatccccgccggtcaagcggtctcctacggcggtacctgg
accgcgcccaccagccgctgggtcggcctcgtgcccctcggttacgccgacggcatcccg
cgctcggcctccggcgcccccgtcacggtgctcccctccccgcccagcgccgcgcccggc
gccgacgacggcgccgttccgatccacgccaggatcgtgggtcgcgtgtgcatggaccag
atggtcatcgatctcgggcccgcggcccccgccggtggccccgccggagaggagcccccg
gcccgtgccggtgacaccgccgtcctgtggggcgacggcgctgatccggcgggcatcccg
acggcggacgagtgggccgccgcatgcggcaccatcaactatgagatcgtcacccgtctc
ggcgcgcgcgtgccccgggtacatctgggagttggctgggaggatagagtctga

DBGET integrated database retrieval system