KEGG   Actinoalloteichus sp. GBA129-24: UA75_13660Help
Entry
UA75_13660        CDS       T04619                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
acti  Actinoalloteichus sp. GBA129-24
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APU20742
UniProt: A0A1L7F7F3
LinkDB All DBs
Position
3088990..3090447
Genome map
AA seq 485 aa AA seqDB search
MTSADVATSAGAARAADRSRFYLDGQWTEPLGGGVIPVENPYTERIIATVPAGSVRDVDR
AVAAARAAATPWAATPPAVRAEHLARLADAVAARAEDLAATIGRELGAPQRVAAAVHVGM
PLTVLRGIAETAARPPAEETVGNSLVVREPVGVVAAITPWNYPLHQVVAKVAPALAAGCP
VVLKPSEVTPLTAYLFFDAVHEAGLPPGVLNLVVGTGPVVGEALAGHRDVDMVSFTGSTA
VGARISHLAADRIARVALELGGKSANLVLADADLPAAVRAGVGKAFLNSGQTCTAWSRML
VDRSRYAEAVELAEQSARRFTLGDPVAPQTRLGPLVSAAQRDRVLGHVDRAVADGARLVI
GGSDAEVPAQGHFVAPTVFADVDPDGALAQEEVFGPVLAIIPVADDAEAVAVANNSRYGL
AGAVWSADAERALAVARSLRTGAVDVNGGAFNPAAPFGGYRQSGLGRELGAHGIAEFTEV
KAIQR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcagacgtcgccacatcagccggggcggcgcgagccgccgaccgcagcagg
ttctatctggacggacagtggacggagccgctcggcgggggcgtcatccccgtcgagaac
ccctacaccgagcggatcatcgccacggtgcccgccgggtccgtacgggacgtggaccgg
gcggtggccgccgcccgtgccgccgcgacgccgtgggcggccaccccgcccgccgtgcgg
gccgagcacctcgcccgactggccgacgcggtcgcggcgcgggccgaggacctcgccgcc
accatcggccgggaactcggtgcgccgcagcgggtggccgccgccgtgcatgtcggaatg
ccgctgacggtgttgcgcggcatcgccgagacggccgcccggccgccagcggaggagacc
gtcggcaactccctggtggtccgggagcccgtcggggtcgtcgccgcgatcaccccgtgg
aactacccgctgcatcaggtggtcgccaaggtggcgcccgcgctggcggcgggctgtccg
gtggtcctcaagcccagcgaggtgaccccgctgacggcgtacctcttcttcgacgccgtc
cacgaggcgggactgccgcccggcgtgctcaacctggtcgtcggcaccggtccggtggtc
ggcgaggcgctggccgggcaccgggacgtcgacatggtctccttcaccggctccacggcc
gtcggcgcccggatctcccacctggccgccgatcggatcgcccgcgtcgccctggagttg
gggggcaagtcggccaacctcgtcctggctgacgccgacctgcccgccgccgtccgtgca
ggcgtcggcaaggccttcctcaactccggccagacctgcaccgcgtggagtcggatgctg
gtggaccgcagccggtatgccgaggccgtcgaactggccgagcagtccgcccgccgcttc
accctcggcgaccccgtcgccccgcagacccgcctcggcccgctggtctcggccgcgcag
cgtgatcgggtactcggccacgtcgaccgcgccgtcgccgacggagccaggctggtgatc
ggcggatccgacgccgaagtgcccgcgcagggccatttcgtcgcccccaccgtgttcgcc
gacgtcgatcccgacggcgcgctcgctcaggaggaggtcttcggcccggtcctggcgatc
atccccgtcgccgacgacgccgaggccgtcgcggtggccaacaactcgcgctacggcctc
gccggagcggtctggtccgccgacgccgaacgggcgctggcggtggcgcggtcgctgcgt
accggcgcggtcgacgtcaacggcggtgcgttcaaccccgccgcgcccttcggcggctac
cgccagtccggtctcggcagggagttgggcgcgcacggcatcgcggagttcaccgaggtg
aaggcgatccagcgatga

DBGET integrated database retrieval system