KEGG   Actinoalloteichus sp. GBA129-24: UA75_29430Help
Entry
UA75_29430        CDS       T04619                                 

Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acti00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    UA75_29430
Enzymes [BR:acti01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     UA75_29430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6897804..6899081
Genome map
AA seq 425 aa AA seqDB search
MSERGAAGTNDGDRDGWSGSAETAELAERAHLLDRSDPLATTRERFSLPPGLIYLDGNSL
GALPTAVPERVAETIRRDWGQGLIASWWDAGWWEAPQRVGELIAPLLGAAPGQVVVGDST
SVNVFRAVVAGWRLAQQDDPGRTEIVVDDTTFPTDGYLAASAGRLLGARVRRAHPTDVNA
FDEHTAVALINHVDYRTGRRWDLPAVTSRAQRAGARIVWDLSHSAGAMPVDLDRHGVDLA
VGCGYKFLNGGPGAPSYLYVRSELQDRLDQPLPGWSSHAEPFAMEADHRPAPGIVRARGG
TPEILSLLALEAALEVWQGVEIEQVRAKSLALTGFFMECVDALTEPGRFRVLTPRGDDRG
SQVSLSAPDAAALLPRLADALVVGDHRPPDVLRFGFAPLYVGFTDALRAARTLARVAGRR
DVTAG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcgcggtgcagccggtacgaacgacggcgaccgggacggctggtcgggatcg
gccgagacagccgaactggccgaacgtgcccacttactggaccgatccgacccgctcgcg
acgaccagggaacggttctcgctgccgcccgggctgatctacctggacggcaactcgctc
ggggcgctgcccacggcggtcccggaacgcgtcgcggagacgatccggcgggactgggga
cagggcctcatcgcctcgtggtgggacgcaggctggtgggaggcgccgcaacgggtcggc
gagctgatcgcgccgttgctgggagccgcacccggccaggtcgtcgtgggcgactcgacc
agcgtgaacgtgttccgcgccgtggtcgcgggttggcggctggcgcagcaggacgaccca
ggacgcaccgagatcgtcgtcgacgacaccaccttcccaaccgacggctacctcgccgca
tccgcaggcaggcttctcggtgcgcgggtgcgacgagcacacccgacggatgtgaacgcc
ttcgacgagcacacggcggtcgcgctgatcaatcatgtcgactaccgcaccggtcgccgc
tgggatctgcccgccgtcacctcgcgggcgcagcgggcgggggcacgcatcgtgtgggac
ctgtcgcacagcgcgggagccatgcccgtcgacctggaccgccacggcgtcgatctcgcc
gtgggatgcggctacaagttcctcaacggcggtccgggggcaccgtcctacctctacgtg
cgatccgagctgcaggatcggctcgatcagccgctgcccggctggtcctcgcatgcggag
cccttcgcgatggaggcggaccatcggcctgcccctggaatcgtccgagcgcggggcggc
actccggagatcctgtcgctgctggcgctggaggccgccctggaggtctggcagggcgtc
gagatcgaacaggtgcgggccaagagcctggcactgacggggttcttcatggagtgcgtg
gacgcgttgacggaaccgggacggttccgggtgctgacgccccgaggcgacgatcgaggc
agccaggtctcgttgagcgcccccgacgccgccgcgttgctgccccgcctcgccgacgca
ctggtcgtcggcgaccaccgcccgccggacgtgctgcgcttcggcttcgcaccgctgtac
gtcggattcaccgacgcactgcgggccgcgaggacactggcccgagtggcggggcgccgg
gacgtgaccgcaggctga

DBGET integrated database retrieval system