KEGG   Actinoplanes sp. N902-109: L083_3461Help
Entry
L083_3461         CDS       T02655                                 

Definition
(GenBank) alcohol dehydrogenase groes domain-containing protein
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L083_3461
  Lipid metabolism
   00071 Fatty acid degradation
    L083_3461
  Amino acid metabolism
   00350 Tyrosine metabolism
    L083_3461
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L083_3461
   00626 Naphthalene degradation
    L083_3461
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     L083_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4116840..4117850)
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTGFDQPVQVKEVPVPEPGPGQIQVRIEASGLCHTDIHAARGDWPVKPAPPFVPG
HEGVGIVERTGPGVTEHRVGDRVAVPWLGHACGTCEYCITGWETLCEQQLNTGYAIDGGH
AEFLVADARYAVAVPAGLDPAEAAPLTCAGVTTYKAVKVGGVTPGDRVAIFGVGGLGHLA
LQYAQIFGGETIAVDVTEEKLALAKQLGAAHVVNAATTDPVAAIEALGGADVAVVLAADP
TVLEQAHAALRRGGRLVLVSLPKDNTMALPIFQTVLKGIRVIGSIVGSRADLAAVFRLHA
AGRTRVILQTRPLEQINDAIDEVLAGRVPARLVLIP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccgtggtcaccggcttcgaccagcccgtgcaggtcaaggaggtgcccgtc
ccggaaccggggccgggccagatccaggtccggatcgaggcgagcgggctgtgccacacc
gacatccacgccgcccgcggcgactggccggtcaagcctgccccgccgttcgtgccgggg
cacgagggcgtcggcatcgtggagcgcaccgggccgggcgtcaccgagcaccgggtcggc
gaccgggtcgctgtcccctggctcgggcacgcatgcggcacctgcgagtactgcatcacc
ggctgggagacgctgtgcgagcagcagctcaacaccggctacgcgatcgacggcgggcat
gccgagttcctggtggccgacgcccggtatgcggtcgcggtgcccgccgggctggacccc
gccgaggcggccccgctcacctgcgccggggtcaccacgtacaaggcggtcaaggtcggc
ggggtgacgccgggcgaccgggtggcgatcttcggggtcggcgggctggggcatctcgcg
ctgcagtacgcgcagatcttcggcggggagaccatcgcggtggacgtgaccgaggagaag
ctggccctggccaagcagctcggcgccgcgcacgtggtcaacgccgccaccaccgacccg
gtggcggcgatcgaggcgctcggcggggccgacgtggccgtggtgctggcggccgacccc
acggtgctggagcaggcgcacgccgcgctgcgccggggcggccggttggtgctggtgtcg
ctgcccaaggacaacacgatggcgctgccgatcttccagacggtgctcaaggggatccgg
gtgatcggttcgatcgtgggcagccgggccgatctggccgcggtgttccggctgcacgcc
gccgggcgtacccgggtgatcctgcagacccgcccgctggaacagatcaacgacgcgatc
gacgaggtgctggccggccgggtgccggcgcggctcgtgctgattccctga

DBGET integrated database retrieval system