KEGG   Actinoplanes sp. N902-109: L083_5305Help
Entry
L083_5305         CDS       T02655                                 

Definition
(GenBank) alanine--glyoxylate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    L083_5305
   00650 Butanoate metabolism
    L083_5305
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L083_5305
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    L083_5305
Enzymes [BR:actn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     L083_5305
Amino acid related enzymes [BR:actn01007]
 Aminotransferase (transaminase)
  Class III
   L083_5305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6078177..6079469)
Genome map
AA seq 430 aa AA seqDB search
MNELLARHQAVLPSWVTTYYGADAIELVSGSGRRVTDSTGKTYLDFFGGVLTTMLGHDVA
EVREAVEKQLATGIVHSSTLYLIRHQVELAEKITRLAGIPDARVFFANSGTEANEAALLF
ATNHRRSNQILAIRNSYHGRSFAAMAVTGHRSWSASGLSPLQVSWLHSGDRLRGRLAGLA
DDAFVEAAVDDLREVLATTTAGDVAALIAEPIQGVGGFVHGPDGLLGALKKELDNHGILL
IADEVQTGWGRTGEHFWGYQAHDVQPDLITFAKGIGNGFALAGVVGRADLVNAVPATSFS
TFGGNPVATAAGNAVLDYVLDHDLQANAKRTGDILLTGLRPLAATSPIVAEVRGRGLMIA
LEFCRPHTTDPDPAGTLRVSDECRRRGLLVGKGGLYGNVLRMGPPLTLTEDEAREGLAIL
TDAIHAVERD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaactgctggccaggcaccaggccgtgctgccgtcctgggtgaccacctactac
ggcgccgacgccatcgagctggtgtccggctccggacgccgggtcaccgacagcaccggc
aagacctatctcgacttcttcggcggcgtgctgaccaccatgctcggccacgacgtcgcc
gaggtgcgcgaggcggtggagaagcagctcgccaccggcatcgtgcacagctcgaccctg
tacctgatccgccaccaggtcgaactcgccgagaagatcacccggctcgccggcatcccg
gacgcgcgggtgttcttcgccaactccggcaccgaggccaacgaggcggcgctgctgttc
gccaccaaccaccgccgctccaaccagatcctggcgatccgcaacagctaccacgggcgc
tcgttcgccgcgatggcggtcaccgggcaccgcagctggtcggccagcggcctgagcccg
ctccaggtgagctggctgcactccggcgaccggctgcgcggccggctggccggcctggcc
gacgacgccttcgtcgaggccgccgtcgacgacctgcgcgaggtcctggccaccaccacc
gccggtgacgtcgccgccctgatcgccgagccgatccagggggtgggcggcttcgtgcac
ggcccggacggcctgctcggcgcgctcaagaaggagctggacaaccacggcatcctgctg
atcgccgacgaggtgcagaccggctggggccgcaccggcgagcacttctggggctaccag
gcccacgacgtgcagcccgacctgatcacctttgccaagggcatcggcaacggcttcgcc
ctggccggcgtcgtcggccgcgccgacctggtcaacgccgtcccggcgaccagcttctcc
acgttcggcggcaacccggtcgccaccgctgcgggcaacgccgtgctcgactacgtgctc
gaccacgacctccaggccaacgcgaaacgcaccggcgacatcctgctcaccggcctgcgc
ccgctggcggcgacctcgccgatcgtggccgaggtgcgcggccggggcctcatgatcgcc
ctggagttctgccgcccgcacaccaccgaccccgacccggccggcacgctgcgggtctcg
gacgagtgccggcggcgcggcctgctggtcggcaagggcggtctgtacggcaacgtgctg
cggatgggcccgccgctcaccctcaccgaggacgaggcccgcgaaggcctcgccatcctc
accgacgctatccacgccgtggagcgggactga

DBGET integrated database retrieval system