KEGG   Actinoplanes sp. N902-109: L083_6465Help
Entry
L083_6465         CDS       T02655                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00730  Thiamine metabolism
actn00790  Folate biosynthesis
actn01100  Metabolic pathways
actn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    L083_6465
   00790 Folate biosynthesis
    L083_6465
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L083_6465
Enzymes [BR:actn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     L083_6465
Exosome [BR:actn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L083_6465
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:actn00537]
 Enzymes
  L083_6465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: AGL19975
UniProt: R4LXL9
LinkDB All DBs
Position
7397274..7398596
Genome map
AA seq 440 aa AA seqDB search
MVLAAAAVVAVPSVALAGDAHPDNTKSAKHAIQGGKARNVILLIGDGMGDSEITIARNYQ
VGANGRLNMDKLPLTGAYTTYAVQKQNPALPEYVTDSAASGTGWATGHKTYNGAISVTPD
EKPKPTILELAKAAGYRTGDVTTAELQDATPAVLGSHVVSRDCKGPDAMATCAVNDKVNG
GAGSIAEQLVQTKPDVLLGGGKQYFDQTVKAGTYRGLTVAQQAQVNGYQVVTDAAGLAAA
KPTKPILGAFAKNNMDLEWTGPAPTRTGTAPATCATNTARTATQPHLADMATKAIDVLDR
QSRDSRKGFFLQIEGASIDKQDHAANPCGQIGETVAFDAAVKKVLDYQKKNPDTLVVVTA
DHGHTSQIVETATLGYTATLITHDKANMTISYATSEITGSQQHTGTEVRIAAGGPQAANV
LGVTNQTDLFFTMKRALGLK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggttcttgccgcagccgccgtcgtggccgttccctcggtcgcgctcgcgggcgacgcg
cacccggacaacaccaagagcgccaagcacgcgatccagggcggcaaggcccgcaacgtg
attctgctgatcggcgacggcatgggtgacagcgagatcaccatcgcccgcaactaccag
gtcggcgcgaacggccggctgaacatggacaagctgccgctgaccggcgcctacaccacg
tacgccgtgcagaagcagaacccggccctgcccgagtacgtcaccgactcggccgcctcc
ggcaccggctgggcgaccggccacaagacgtacaacggggccatctcggtgaccccggac
gagaagccgaagccgacgatcctggagctggcgaaggcggccggctaccggaccggtgac
gtcaccaccgccgagctgcaggacgcgaccccggcggtgctcggctcgcacgtcgtcagc
cgcgactgcaagggccccgacgcgatggcgacctgcgcggtcaacgacaaggtcaacggc
ggcgccggctcgatcgccgagcagctcgtgcagacaaagccggacgtcctgctgggcggt
ggcaagcagtacttcgaccagaccgtgaaggcgggcacctaccgggggctcaccgtcgcg
cagcaggcccaggtcaacggctaccaggtggtgacggacgcggccgggctggcggcggcc
aagccgaccaagccgatcctcggggccttcgccaagaacaacatggacctggagtggacc
ggcccggcccccacccgtaccggcaccgccccggccacctgcgcgaccaacaccgcccgt
acggccacccagccgcacctggccgacatggccaccaaggcgatcgacgtgctggaccgg
cagagccgggacagccgcaagggcttcttcctgcagatcgagggcgcctcgatcgacaag
caggaccacgcggccaacccgtgcggccagatcggtgagaccgtggcgttcgacgcggcc
gtcaagaaggtgctcgactaccagaagaagaacccggacaccctggtcgtcgtgaccgcg
gaccacgggcacaccagccagatcgtggagaccgccacgctgggctacaccgccacgctg
atcacgcacgacaaggcgaacatgacgatcagctacgcgacctccgagatcaccggttcg
cagcagcacaccggcaccgaggtgcggatcgccgcgggcggcccgcaggcggccaacgtg
ctcggcgtgaccaaccagaccgacctcttcttcaccatgaagcgggccctcggtctgaag
tag

DBGET integrated database retrieval system