KEGG   Actinoplanes sp. N902-109: L083_6655Help
Entry
L083_6655         CDS       T02655                                 

Definition
(GenBank) DNA primase, small subunit
Organism
actn  Actinoplanes sp. N902-109
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(7615568..7616599)
Genome map
AA seq 343 aa AA seqDB search
MVSVMAKPAEEIEVAGHPVRLTSPDKICFPQRGYTKRDVFEYYLAVGDGIMRALHRRPTT
LQRFPDGLDGEMFFQKRISTRGVPAWVQKAEITFPSGRTAEELCPADLAHVAWAAQMGTI
VFHAWPVRADAPDQPDELRLDLDPQPGTDFSDVVSTAGVVREVLADLGWVGYPKTSGGRG
VHVYVRIRPEWSFVQVRRAAIALAREVERRRPDRITTSWWKEERGERVFLDYNQMARDRT
IACAYSLRANARATVSTPVTWDELGDVEPDDFDLRTVPARLAGTGDPHRTIDDIAYDLTE
LLEWVERDEKAGLGDLPYPPDHPKMPGEPKRVQPSKDRDLKGK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtctctgtcatggccaagcccgccgaagagatcgaggtcgcggggcatcccgtgcgc
ctgaccagcccggacaagatctgcttcccgcagcggggctacaccaagcgggacgtcttc
gagtactacctcgcggtcggcgacggcatcatgcgggcgctgcaccgccggccgaccacg
ctgcagcgcttccccgacggtctcgacggcgagatgttcttccagaaacgcatctccacc
cgcggcgtaccggcctgggtgcagaaggccgagatcaccttcccgagcgggcgtacggcc
gaggagctgtgccccgccgacctcgcccacgtcgcctgggccgcccagatgggcacgatc
gtcttccacgcctggccggtgcgcgcggacgccccggaccagcccgacgagctgcgcctc
gacctcgacccgcagcccggcaccgacttctcggacgtcgtcagcaccgccggggtggtc
cgtgaggtgctcgccgacctcggctgggtcggataccccaagacgtccggcgggcgcggt
gtgcacgtctatgtcaggatccggccggagtggtccttcgtgcaggtccgccgggccgcg
atcgcgctggcccgggaggtcgagcggcgccgccccgacaggatcaccacgtcgtggtgg
aaggaggagcgcggcgagcgggtcttcctcgactacaaccagatggcccgtgaccggacc
atcgcctgcgcctactcgctgcgcgccaacgcccgcgccaccgtgtccaccccggtgacc
tgggacgagctgggcgacgtcgagcccgacgacttcgacctgcgcaccgtccccgcccgg
ctggccggcaccggagacccccaccggaccatcgacgacatcgcgtacgacctcaccgag
ctgctcgaatgggtggagcgcgacgagaaagcgggcctgggcgacctgccctatcccccc
gaccatcccaagatgccgggcgagcccaagcgggtacagccgtcgaaagaccgtgatctc
aaggggaagtga

DBGET integrated database retrieval system