KEGG   Actinomyces gaoshouyii: B6G06_07025Help
Entry
B6G06_07025       CDS       T04911                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
actp  Actinomyces gaoshouyii
Pathway
actp00473  D-Alanine metabolism
actp01100  Metabolic pathways
actp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:actp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B6G06_07025
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B6G06_07025
Enzymes [BR:actp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B6G06_07025
Peptidoglycan biosynthesis and degradation proteins [BR:actp01011]
 Precursor biosynthesis
  Racemase
   B6G06_07025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARD42122
UniProt: A0A1V0KK77
LinkDB All DBs
Position
complement(1708852..1710195)
Genome map
AA seq 447 aa AA seqDB search
MSATTPSTAPPIPATTSRAVIDLGAIAHNAAVLARAAGTAWMAVVKADAYGHGLEPVARA
CLGAGATWLGVAQLAEALHLRSLLDATGIARPAPALRSLPTPDAPRILTWLAPVLTPEDA
AAPGSPLRAAIAADLDLSVSTPDQARAIAAAADAEGRAARVHLKVDTGMSRAGTTDGELP
ALASALVGAERAGSLVVVGLWSHLSRADEPDSGSTEDHLARFRAADAGVTAVGLAPVVRH
LAATGGLLWHPDARLDLVRAGIGLYGLSPDPAVATSAELGLRPTMRLEAPLALVKRIPAG
QAVSYGGTWTAPTSRWVGLVPLGYADGIPRAASGAPVTVIPSPVGSSVSADAAVPPPIRT
RIVGRVCMDQVVIDLGPAARAGDTAGGEPPARAGDTAVLWGDGADPAGIPTVDEWAAVCG
TINYEIVTRLGARVPRIYLGVDWEDRV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgacaacaccttccactgcaccgccgatcccggccaccacctcccgggccgtc
atcgacctcggcgccatcgcccacaacgccgccgtcctcgcccgggccgccggcactgcc
tggatggctgtcgtcaaagccgatgcctatgggcacggcctggagcccgtcgcgcgcgcc
tgcctcggcgccggcgccacctggctcggcgtcgctcagctcgccgaggccctccacctg
cgctccctcctcgacgccacgggcatcgcgcgccccgcccctgctctccgctcactgccg
acgccggatgcgccgcgcatcctcacctggctcgcccccgtcctcacccccgaggacgcc
gcagccccgggctcccccctgcgcgcagcgatcgccgcagacctcgacctctccgtgtcc
acccccgaccaggcccgcgccatcgcggccgccgccgatgccgaggggcgcgccgcccgc
gtccacctcaaggtcgataccggcatgtcccgcgccggcacgaccgacggcgagctcccc
gcgctggcctccgccctcgtcggggccgagcgcgccgggagcctcgtcgtcgtcggcctg
tggtcccacctctcgcgcgccgatgagcccgactccggttccaccgaggaccacctggcc
cgcttccgagccgccgacgccggcgtcaccgcggttgggctcgcgccggtcgtccgccat
ctcgcggccactggcgggctgctctggcaccccgacgcgcgcctcgacctcgtgcgcgcg
ggcatcgggctctacgggctctcacccgacccggccgtcgccaccagcgccgagctcggg
ctgcgccccaccatgcgcctggaagcccccctggcgctcgtcaagcgcatccccgcaggt
caagcggtctcctacggtggtacttggaccgctcccaccagccgctgggtcggcctggtc
cccctcggctacgccgacggcatcccgcgcgcggcctccggcgcccccgtcacggtgatc
ccctccccggtcggctcatcagtcagtgccgacgccgccgtcccgcccccgatccgcacc
aggatcgtgggccgcgtgtgcatggaccaggtggtcatcgacctcgggcccgcggcccgg
gccggtgacaccgccgggggcgaacccccggcccgggccggtgacaccgccgtcctgtgg
ggcgatggcgctgatccggcgggcatcccgacggtggacgagtgggccgccgtatgcggc
accatcaactatgagatcgtcacccgtctcggcgcgcgcgtgccccgaatctatctggga
gttgactgggaggatagagtctga

DBGET integrated database retrieval system