KEGG   Actinomyces gaoshouyii: B6G06_08515Help
Entry
B6G06_08515       CDS       T04911                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
actp  Actinomyces gaoshouyii
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:actp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    B6G06_08515
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B6G06_08515
Enzymes [BR:actp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     B6G06_08515
Bacterial toxins [BR:actp02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   B6G06_08515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2045471..2047630)
Genome map
AA seq 719 aa AA seqDB search
MRTHHPRIPAILGAGAIALTGLTIAPTAQAAKTTDGRMDIGITKVADANDGVYAVGDTLA
FNINVTNLDAEARSFEVAQTNLGGRVTACKWRNIAAKATKTDCTGYATHTITQADLDAGS
FTPEISYTVRAPEYKGDALNTPETVRGEAVPIKAAPPGQDAPKDPQEPEEEKGDFPKAEP
APLPDASVSLPASMSDGTAVATGTATDNVRIPAITTAPNGDLLVAYDVRPTDNGNKGGDS
PNPNHIVQRRSTDGGKTWGAPTYIHKGVETGTKEGYSDPSYVVDSATGTIFNFHVKSYDV
GFAASQPGKDAQARNVIHAEVSTSTDNGHSWTHRVITPDITNDPSWISRFAASGQGIQIQ
HGQYKGRLVQQFTIKLASGAFQAVSVYSDDHGATWKAGTPAGTGMDENKVVELSDGRLMM
NSRVSDGSRYRKIATSTDGGQTWSKPISDKNLPDSVNNAQIIRAFPNAAPGTDRAKVLLL
SHSPNPKAWSRDRGTISLSCDDGATWTGKVFRAERVGYTTLAVQSDGSLGLLSEDGNDRQ
IVYRNFSLAWLGSECPALKDDPSPEPKPEEPPAPAPKAGWEKDGDAWRYRNADGGLATGW
LKDGDAWYYLRADGTMATGWVKDGDAWYLLQDNGAMATGWAKDGGKWYHFAASGAMTTGW
IRLAGTWYHLGASGAMTTGWLQEGGSWYYLRDNGAMATGWVAVGPSRYYMDPVTGGWRG
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcaccacccccgtatcccagcgatcctgggagccggtgccatcgcgctcacc
gggctcaccatcgccccgacggcgcaggcggccaagaccaccgatggccgcatggacatc
ggcatcaccaaggtcgctgatgccaatgacggcgtctacgccgttggggacacactggcc
ttcaacatcaacgtcaccaacctggacgcagaggcgcgctccttcgaggtcgctcagacc
aatctcggaggccgagtcaccgcttgcaagtggcgcaacatcgctgccaaggccactaag
accgactgcacgggttacgccactcacaccatcacccaggctgacctcgatgcgggctcc
ttcaccccggagatctcttacactgtccgcgcccccgagtacaaaggcgatgccctcaac
actcctgagacggtccgcggcgaggctgtgccgatcaaggccgcccctcctggacaggac
gcgcccaaggacccgcaggagcccgaggaggagaagggcgacttccccaaggccgagccc
gcgcccctgccggacgcctcggtgtcgttgccggcctcgatgagtgacggcaccgcggtg
gccaccggcaccgccacggacaatgtccgcattcctgccatcaccaccgcgcccaatggc
gaccttctcgtggcgtatgacgtgcggcccacggacaacggtaataagggaggcgactcg
cccaacccgaaccacatcgtccagcgccgctccaccgacggcgggaagacctggggcgcg
cccacctacatccacaagggcgtcgagaccgggaccaaggagggctactccgacccctcc
tacgtcgtcgactccgccacgggcacgatcttcaacttccacgtgaagtcctatgacgtc
ggttttgcggcgtctcagcccggtaaggacgcgcaggcccgcaatgtcatccatgccgag
gtctccacctccacggataacggccacagctggactcaccgcgtcatcaccccggacatc
acgaatgatccctcatggatctcccgcttcgccgcctccggccagggaattcagatccag
cacggccagtacaagggacgcctcgtccagcagttcaccatcaagctcgccagcggggcc
tttcaggccgtgtccgtctactccgatgaccacggcgctacctggaaggctgggactccg
gccggtaccggcatggatgagaacaaggtcgtggagctctccgacggtcgcctcatgatg
aactcgcgcgtctccgacggctcccgctaccggaagatcgcgacctctaccgacggcggc
cagacctggtcaaagccgatctcggacaagaacctgcccgattcagtgaacaacgcccag
atcatccgggccttccccaacgccgctccgggcacggaccgcgccaaggtcctcctgctg
agccactcgccgaaccccaaggcatggtcgcgtgaccgcggcacgatctcgctgtcctgt
gacgacggcgccacctggacgggcaaggtcttccgcgctgagcgtgtcggctacacgacg
ctggccgttcagtccgatggctcgctgggcctgctcagcgaggacgggaacgatcggcag
atcgtctaccgcaacttctccctggcctggctgggcagtgagtgccccgccctcaaggac
gacccgagccctgagcccaagcccgaggagcctcctgcccccgccccgaaggctggttgg
gagaaggatggtgacgcttggcgctaccgcaatgctgacggcggtctcgccaccgggtgg
ctcaaggatggagacgcctggtactacctgcgagccgacgggacgatggccacggggtgg
gtcaaggatggcgacgcctggtacctcctccaggacaacggcgccatggccaccggctgg
gccaaggacggcgggaagtggtaccacttcgctgccagtggggcgatgaccaccggctgg
atccgcctggccggcacctggtaccacctgggggccagtggggcgatgaccaccggctgg
cttcaggagggcggctcctggtactacctgcgggacaatggcgccatggccactggttgg
gtcgcggtcggcccgagccgctattacatggatcccgtcacggggggctggcgcggctga

DBGET integrated database retrieval system