KEGG   Acidithiobacillus caldus SM-1: Atc_2677Help
Entry
Atc_2677          CDS       T01581                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Atc_2677
Enzymes [BR:acu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Atc_2677
Transporters [BR:acu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Atc_2677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_N_4 GST_C_3 Tom37 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AEK59324
UniProt: F9ZU28
LinkDB All DBs
Position
2731735..2732391
Genome map
AA seq 218 aa AA seqDB search
MTLELISFPLCPYVQRSVITLLHKEVLFTLTHIDLAHKPDWFLQISPMGKVPCLRVDDDV
VLFESQVINEYLDETTPPPLHPADPLERARHRSWIAFGGDALADQFQMMVAQGEERFTAA
HRQLFEKLERLEAAASDGPFFAGDSFSLVDAAYAPLFMRMEILHNLRPLPRWESLGKLRR
WAAHLLELPEVAASVQPGFPEQIRNYLSEKGSLLLRSA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacactggaattgatcagcttccctctgtgtccttacgttcagcgctcggtcatcacg
ctcttgcacaaggaagtgctcttcaccctcacccacatcgatctcgcccacaagcccgac
tggttcttgcagatctcccccatgggcaaggtaccctgcctgcgcgtcgacgacgatgtc
gtgctttttgagtcccaggtcatcaacgaatacctggacgagaccacccccccgcccctg
caccccgccgaccctctggagcgcgcccgccatcgctcctggattgcctttggcggcgac
gccctggccgatcagttccagatgatggtggcgcagggtgaggaacgcttcacggcagcc
caccgtcagctcttcgaaaaactcgaacgtctggaggccgccgccagcgacgggcctttc
tttgccggcgattccttcagcctggtggatgccgcctacgcgcccttgttcatgcgcatg
gaaattctgcacaacctgcgcccattgccacgctgggaatccttgggcaaactgcggcgg
tgggcagcacaccttctggagctaccggaagtggccgcgtcggtgcagccgggttttccc
gagcagattcgtaactatctgagcgaaaaaggcagcctgctgctgcgctcagcctga

DBGET integrated database retrieval system