KEGG   Azotobacter chroococcum: Achr_38920Help
Entry
Achr_38920        CDS       T03640                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
acx  Azotobacter chroococcum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4344798..4350095)
Genome map
AA seq 1765 aa AA seqDB search
MNSMPPSVPRYPRNFVEHLCHLAAERPTDTALIVVREQDGAPADTLISYAALDRRVRALA
AQLQERFGPGERALLLLDNDDHYVVAFFACLYAGLTAVPVFPPESARPQHLARLTGIAQD
AQARCLLTTGAILTLLGTAVDGFAGCAALAVDAVDAAGADAWRPHAPADDDIAFLQYTSG
STSAPKGVMVSHGNLMANERAIEEGLSVGPDDVFVSWLPLYHDMGLIGGLLQPVHRGIPV
ALMTPQFFLERPIRWLEAISRHRGSISGGPDFAYRLCLERVKDAQLAQLDLSSWRLAFSG
AEPVRHDTLEAFIERFAPAGFQAGAVFPCYGLAEATLFVTGGRRGTGMVTRAFSAESLGQ
DRAQRDDGGNIHVGCGHAPSAHEVRIVDPQSLATLGEGAVGEIWASGPSIAQGYWQRPEE
TAQSFVERDGRRWLRTGDLGFLHEDELYITGRIKDLIILRGQNVYPQDIERTIEAEVEVV
RKGRVAAFAVPLPAGGEGVGVAVEVSRGLQNLVRVEALVEALSRAAAGVCREPVSVAVLL
NPGALPKTSSGKLQRSACRRGWERGKLDAYALYEHGRFVLGAGQQAADPVAAQPPFDELE
AALAQLWQQVLGTGGAPERQAHFFAGGGNSLAAVQLAARIGEQWEIDFPVRLLFERPRFD
ELAAEIRNAQAQGRRQPKAAIPVLPVERRGEPLPLSHAQARQWFLWQLDPKSSAYHLSLV
LRLSGPLRVDALRAAFDGLVARHESLRTVFRPAADGMPAQWIQNAIEVDLPLIDLREVAA
GEREAQAAEQARRLVETPFDLTCGPLLRVALIRTADEAQRLVLVMHHIVSDGASMQVLID
ELAARYAAHLQGRAAELAAPAIQYADYALWQRDWLAAGEGARQLDWWRAQLGDEHPLLSL
PSDHPRQARAGYRAARHSVELPAELSARLRQLAEARGATLFMVLLAGFQALLHRYTGQQD
IRVGVPVANRQRTETAGLIGFFVNTLVMRNLVHGRSRLDEVLAQTREMALGAQGHQDLPF
EQLVEALQPERSLSHSPLFQVLFNHLHEDWRALRQLPGLVPQPEEADERAAQFELALDIR
ERSDGQIRASFEYAAELFEAQTIERLAGHYLAVLRALAERPEQALGDLALLGEAEQAQLC
QWGENPQRYPDAGPLHRLFERQARERPQATALVFGAEALSYAELNRRANRLAHRLIALGV
RPETKVGIALERSVEMVVGLVAILKAGGAYVPLDPDHPGERLAWMAGDSGIGLLLTQSHL
KGRIPGQALSVLALDSLDLAGEPEHDPQVALHGDNLAYVIYTSGSTGRPKGAANRHRSLY
NRLAWMQEAYRLDASDSVLQKTPFGFDVSVWEFFWPLMVGARLVVANPGEHRDPGRLVET
IRQHAVTTLHFVPSMLQAFLAHEGIEACTSLSRIFCSGEALPAEAQNAVFRRLPQAALYN
LYGPTEAAIDVTHWSCRDDGQSQVPIGRPIGGIRTWVLDAALNPVPPGVAGELYLGGVGL
ARGYLNRPALTAERFVADPFGSGERLYRSGDLVRWNSEGQLEYLGRIDHQVKVRGFRIEL
GEIEAQLLAQPEVREALVVAREGPGGVQLVGYLSAPAGQALDGALLRERLGRVLPDYMVP
SALVVLESLPLNPNGKVDRKALPEPELAGSQAYEAPLGEIEERLAEVWAEVLGMGMERVG
RRDSFFEIGGHSLLLLKVHHRLKERLEVCPSVVELFKYPTIESLAAFLGEGGPHDSASLQ
RAEDRARRQRGAFLQRKPASERTPT
NT seq 5298 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatgccgccgtcagtaccccgctatccccgcaacttcgtcgagcacctgtgc
cacctggctgcagagcggccgaccgacaccgccctgatcgtggtcagggagcaggacggc
gcgcccgccgacaccctcatctcctacgccgcgctggaccggcgcgtcagggccctggcc
gcgcaactgcaggagcgcttcggcccgggcgagcgcgccctgctgctgctcgacaacgac
gaccattatgtcgtcgccttcttcgcctgcctctacgccgggctgaccgcggtgccggtg
ttcccgcccgagtcggcccgcccgcagcatctggcgcggctgaccggcatcgcccaggat
gcgcaggcccgctgcctgctcaccacgggcgcgatcctcacgctgctcggcacggcggtc
gacggcttcgccggctgcgcggccctcgccgtcgacgcggtcgatgccgccggcgccgat
gcctggcgaccgcacgcgccggccgacgacgacatcgccttcctgcaatacacctccggc
tcgacctcggcgcccaagggcgtcatggtcagccatggcaacctgatggccaacgagcgc
gccatcgaggagggcctgtcggtcggcccggacgacgtcttcgtctcctggctgccgctc
taccacgacatggggctgatcggcggactgctgcagccggtgcaccgcggcatccccgtc
gcgctgatgaccccgcagttcttcctggagcggccgatccgctggctggaggcgatctcc
cggcatcgcggcagcatcagcggcggcccggacttcgcctaccgcctgtgcctggagcgg
gtcaaggacgcgcagctggcgcagctcgacctgtcgagctggcggctggccttctccggc
gccgagccggtgcgccacgacaccctcgaggccttcatcgagcgcttcgcgccggccggc
ttccaggccggcgcggtctttccctgctacggcctggccgaggcgacgctgttcgtcacc
ggcgggcggcgcggcaccggcatggtcacccgggccttctcggccgagtccctgggtcag
gaccgggcacagcgcgacgacggtggcaatatccatgtcggctgcggccacgcgccctcg
gcgcacgaggtgcggatcgtcgatccgcagtccctggccaccctgggcgagggggcggtg
ggcgagatctgggcgagcggcccgagcatcgcgcagggctactggcagcggccggaagag
actgcgcagagcttcgtcgagcgcgatggccggcgctggctgcgcaccggcgacctgggc
ttcctgcacgaggacgagctctacatcaccggacgcatcaaggatctgatcatcctgcgc
ggacagaacgtctacccgcaggacatcgagcggaccatcgaggccgaggtcgaggtggtg
cgcaagggccgcgtggcggccttcgccgtgcccctgccggcgggcggcgaaggggtcggg
gtggcggtggaggtctcgcgcggcctgcagaacctcgtgcgcgtcgaggcgctggtcgag
gcgctgagccgggccgccgccggcgtgtgccgcgagccggtgtcggtcgccgtgctgctc
aacccgggcgcgctgcccaagacctccagcggcaagctgcagcgcagcgcctgccgccgc
ggctgggagcgcggcaagctcgacgcctacgcgctctacgagcacggccgcttcgtgctc
ggcgccgggcagcaggcggccgatccggtagccgcgcagccgcccttcgacgaactggaa
gccgccctggcgcagctctggcagcaggtgctcggcacaggcggcgcaccggagcgccag
gcgcacttcttcgccggcggcggcaattcgctggcggcggtgcaactggccgcgcgtatc
ggcgagcagtgggaaatcgacttcccggtgcgcctgctgttcgagcggccgcgcttcgac
gagctcgccgcggagatccgcaacgcccaggctcaaggccggcgccagccgaaggcggcg
attcccgtcctgccggtcgaacgccgtggcgaacccctgccgctgtcgcacgcccaggcg
cgccagtggttcctctggcagctcgaccccaagagcagcgcctatcacctgagcctggtc
ctgcgcctgtccgggccgctgcgggtcgatgccctgcgcgccgccttcgacggcctggtc
gcccggcacgaatccctgcgcacggtgttccgcccggccgccgacggcatgcccgcgcag
tggatacaaaacgccatcgaggtcgatctgccgctcatcgacctgcgcgaggtggcggcc
ggcgagcgcgaggcccaggcggcagagcaggcgcgccgcctcgtcgagacgcccttcgac
ctgacctgcgggccgctgctgcgcgtggcgctgatccgcaccgccgacgaggcgcagcgg
ctggtgctggtgatgcaccacatcgtctcggacggcgcctcgatgcaggtgctgatcgac
gaactcgccgcgcgctatgccgcccatctgcagggcagggccgccgagctggctgcgccg
gccatccagtacgccgactacgccctctggcagcgcgactggctggccgccggtgagggc
gcgcgccagctcgactggtggcgcgcgcagctcggcgacgagcatccgctcctgagcctg
cccagcgaccatccgcgccaggcgcgggccggctaccgcgccgcacggcatagcgtcgag
ctgccggccgagctgtcggcccgcctgcgccagctcgccgaggcgcgtggagcgacactg
ttcatggtgctgctggccggcttccaggcgctgctgcaccgctacaccggccagcaggac
atccgcgtcggcgtgccggtggccaaccgccagcgcacggagaccgcggggctgatcggc
ttcttcgtcaacaccctggtgatgcgcaacctcgtgcacgggcgcagccgcctggacgag
gtgctggcacagacccgcgaaatggcgctgggcgcccaggggcaccaggacctgcccttc
gagcaactggtcgaggcgctgcagccggagcgcagcctgagccacagcccgctgttccag
gtgctgttcaaccacctgcacgaggactggcgggcgctgcggcaactgccggggctggtc
ccgcagcccgaggaggcggacgagcgggccgcgcagttcgagctggcgctggacatccgc
gagcgctccgacgggcagatccgcgccagcttcgaatatgccgccgagctgttcgaggcg
cagaccatcgagcgtctggccggacactatctggccgtgctgcgcgcgctggccgagcgg
ccggagcaggcgctgggcgacctcgcgctgctgggcgaagccgagcaggcgcagctgtgc
cagtggggtgagaacccgcagcgctacccggacgccgggccgctgcaccggctgttcgag
cgccaggcgcgcgagcggccgcaggccacggcgctggtcttcggcgccgaggcgctgagc
tatgccgaactgaaccgccgcgccaaccgcctggcgcaccggctgatcgccctgggcgtg
aggccggagacgaaggtgggcatcgcgctcgagcgctcggtcgagatggtggtgggcctt
gtggccatcctcaaggccggcggcgcctacgtgccgcttgacccggaccatccgggcgag
cggctggcctggatggccggggacagcggcatcgggctgctgctcacgcagagccatctc
aagggacgcattcccggccaggcgctgagcgtgctggcgctggacagcctcgacctcgcc
ggcgagcccgaacacgacccgcaggtcgcgctgcacggcgacaacctcgcctacgtgatc
tacacctccggctccaccggccggcccaagggcgcggccaaccggcaccgttcgctctac
aaccggctggcctggatgcaggaggcctaccggctcgacgcatcggacagcgtgctgcag
aagaccccgttcggcttcgacgtctcggtctgggagttcttctggccgctgatggtcggc
gcgcggctggtggtggccaatccgggcgagcatcgcgacccggggcggctggtcgagacg
atccgccagcatgcggtgaccacgctgcacttcgtgccctcgatgctgcaggcctttctg
gcgcacgagggcatcgaggcgtgcaccagcctctcgcgcattttctgcagcggcgaggcg
ctgccggccgaggcgcagaacgcggtgttccggcgcctgccgcaggcggcgctgtacaac
ctctacggcccgaccgaggcggccatcgacgtcacccactggagctgccgcgacgacggg
cagagccaggtgccgatcggccggccgatcggcggcatccgcacctgggtgctggatgcg
gcgctgaacccggtgccgccgggggtggccggcgagctgtacctgggcggcgtgggcctg
gcgcgcggctacctgaaccggccggcactgaccgccgagcgcttcgtggccgacccgttc
ggctcgggcgagcggctctatcgcagcggcgatctggtgcgctggaacagcgaaggccag
ctcgaatacctggggcgcatcgaccatcaggtgaaggtgcgcggtttccgcatcgagctg
ggcgagatcgaggcgcagctgctggcccagccggaggtgcgcgaggcgctggtggtggcc
agggaggggccgggcggggtgcagctggtgggctacctgtcggcgccggcggggcaggcc
ctcgacggcgcgctgctgcgcgaacgcctgggccgggtgctgccggactacatggtgccg
agcgccctggtggtgctggagagcctgccgctgaaccccaacggcaaggtcgaccgcaag
gcgctgcccgagccggagctggccggcagccaggcctacgaggcgccgctgggcgagatc
gaggagcggctggccgaggtctgggccgaggtgctgggcatgggcatggagcgcgtgggg
cgccgcgacagcttcttcgagatcggcggccactcgctgctgctgctcaaggtccaccat
cgcctgaaggaacgccttgaggtctgcccctcggtcgtcgagctcttcaaatacccgacc
atcgagtccctggcggccttcctcggcgagggcggcccgcacgacagcgcttcgctgcag
cgcgccgaggaccgggccaggcgccagcgcggcgccttcctgcaacgcaagccggccagc
gagaggacgcccacatga

DBGET integrated database retrieval system