KEGG   Anabaena cylindrica: Anacy_4460Help
Entry
Anacy_4460        CDS       T02435                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K11951  
bicarbonate transport system permease protein
Organism
acy  Anabaena cylindrica
Pathway
ABC transporters
Module
Bicarbonate transport system
Brite
KEGG Orthology (KO) [BR:acy00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Anacy_4460
Transporters [BR:acy02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Bicarbonate transporter [MD:M00321] [OT]
    Anacy_4460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5050027..5050866
Genome map
AA seq 279 aa AA seqDB search
MTVAQKRSTSPKFDNKFLSSLQKQFPELLPPVIAILIFLTIWQLFSWTPGATLPGPIKVI
QDTWILILYPFYDKGGTDKGLFWQILASLQRVAISYTLAAIVGIGLGVLIGVNQTMAKAL
DPLFQLLRTVPPLAWVPISLAALRQNEPAALFVIFITSLWPILINTAVGVTQIPQDYNNV
AKVLQLSKKEYFFNILIPSALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGFFIWDAY
QNNNVSEVILALVYIGVVGLILDKLMAALQNWILPTEQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacagtagcccaaaaacgttccacaagtcctaaatttgataataaatttttatcaagt
ttgcaaaagcaatttcctgaacttctccctccagttattgcgatcctcatcttcttaact
atttggcaattattctcttggactccaggggcaacactaccagggcccatcaaggttatt
caagacacttggatcttgattttgtatcccttctatgacaaaggaggcacagataaaggg
ctgttctggcaaattttagctagtttacaaagggtagctattagctatacattagcggca
attgtcggtattggcttgggtgttttgattggtgtaaatcaaactatggcaaaggcttta
gatcccctatttcagttactaagaactgtaccacctttggcttgggttcccatttcctta
gcagctttacgccaaaacgaaccagcagcattattcgttattttcatcacctcactttgg
ccaattctcattaacactgcggtgggtgtaactcaaatcccccaagattacaataacgtt
gctaaagttctgcaactttctaaaaaagagtatttctttaacatcttaattccttcagca
ttaccttacattttcacaggattaagaattgccattggtttggcttggttagcgattatc
gcagcagaaatagtcatgtccggtattgtcggaattggcttttttatctgggatgcttat
caaaataacaacgtcagtgaagttattttagctctagtttatatcggtgttgttggtcta
atcctagataaactcatggcggcgctacaaaactggattttacctactgagcaaaaatag

DBGET integrated database retrieval system