KEGG   Anser cygnoides domesticus (swan goose): 106030903Help
Entry
106030903         CDS       T04896                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00010  Glycolysis / Gluconeogenesis
acyg00051  Fructose and mannose metabolism
acyg00052  Galactose metabolism
acyg00500  Starch and sucrose metabolism
acyg00520  Amino sugar and nucleotide sugar metabolism
acyg01100  Metabolic pathways
acyg01200  Carbon metabolism
acyg04910  Insulin signaling pathway
Module
acyg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
acyg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acyg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106030903
   00051 Fructose and mannose metabolism
    106030903
   00052 Galactose metabolism
    106030903
   00500 Starch and sucrose metabolism
    106030903
   00520 Amino sugar and nucleotide sugar metabolism
    106030903
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106030903
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    106030903
Enzymes [BR:acyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106030903
Membrane trafficking [BR:acyg04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106030903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 106030903
NCBI-ProteinID: XP_013028384
LinkDB All DBs
Position
Unknown
AA seq 925 aa AA seqDB search
MTRGALAMATWKELNALDVPGYCCSLLCPIDKYLYAMRLSDETLIDIMARFRREMKNGLS
RDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIY
NTPEDIIHGSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGVLITWT
KRFKASGVEGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGT
GTNACYMEEMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQL
FEKMVSGLYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKA
KEILTRLGVEPSHEDCVAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGV
DGSLYKMHPQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDE
TLAEFKLTHEQLLQVKKRMRMEMEAGLKKKSHETAKVKMLPTFVRSTPDGTENGDFLALD
LGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIK
GARLPLGFTFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVV
AVVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNMEWGAF
GDNGCLDDIRTIYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQI
SETLKTRHIFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSKRAAQ
LCGAGMAAVVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCDVTFLL
SEDGSGKGAALITAVGCRLRDAEQN
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaggtgctctcgctatggctacatggaaggagctgaatgccctggatgtgccc
ggctactgctgctccctgctgtgcccaattgataaatacctttacgccatgcggctctcc
gacgaaacgctgatcgacattatggctcgcttcaggagggagatgaagaacggcctctcc
cgagactttaaccctacggccacagtgaaaatgcttccgaccttcgtgaggtccattcct
gatggttcagagaaaggagatttcattgctctggatctcggtggttcttactttcgcatt
ctgcgggtgaaagtgtcgcatgaaaaaaagcagacagtacaaatggaaagcgaaatctat
aacacgcctgaagatatcatacatggcagcgggacacggctttttgatcatgttgctgaa
tgcctgggagactttatggagaaacaacaaatcaaagacaagaagttacccgttgggttt
acgttctctttcccgtgccgacaatccaagctagatgagggtgttctgataacctggaca
aagcgcttcaaagcaagtggagtggagggagcagatgttgtgaagctgcttaacaaggcc
atcaagaaacgtggggactacgatgcagacatcatggctgttgtgaatgacaccgtcggg
acgatgatgacctgtggcttcgatgaccagcgttgtgaagttggcttgatcattggcacc
ggcaccaacgcctgttacatggaggagatgcggcacatagacctggtggaaggggatgag
ggcaggatgtgcattaacacggagtggggggcctttggagatgacggttctctagaagac
atcaggaccgagttcgacagagagatcgaccgtggatccctaaatcctgggaagcagctg
tttgagaagatggtcagcgggctgtacatgggggagctggtgaggctcatcctggtgaag
atggccaaggaggggctgctctttgaagggagaatcacccctgaacttctcaccaaaggg
aagtttgagacaaagcatgtttctgccatagaaaagagcaaagaaggtttgaacaaagcc
aaagaaatcttaacccgcctgggggtggagccgtcccacgaggactgcgtggcggtccag
cacgtctgcaccatcgtgtccttccgctcggccaacctggtggcctccacgctgggcgcc
atcctcaaccagctgcgggacaacaagggggtcggccgcctccgcaccaccgtgggggtc
gatggctccctctacaagatgcatccacagtacgctcggcgcttgcacaaaaccacccgg
cgcctggtgcctgactcggacgtgcggttcctgctgtcggagagcggcagcgggaagggg
gcggcgatggtgacggcggtggcgtaccggctgtcggagcagcaccggctcatcgatgag
acgctggctgagttcaagctcacccacgagcagctgctgcaggtgaagaagaggatgagg
atggagatggaagcaggcctgaagaagaagagtcacgagactgccaaagtgaaaatgctg
cccacctttgtccgcagcacgccggatgggacagagaacggtgactttctggcacttgat
cttggagggacaaactttagagttttgctggtgaaaattcgcagtggtaaaaggagaaca
gttgaaatgcacaacaagatctatgcaattcctatagaggtgatgcagggaacgggagaa
gagctgtttgatcacatcgttacctgcatttctgacttcctggattatatgggaataaaa
ggtgcacggcttcctctcggcttcacgttttccttcccttgcaagcagaccagtctagat
gctggtatcctcctcaactggacaaaaggcttcaaggctacagactgtgagggagaagat
gtggtgtatttgcttagagaaggaattaaaagaagagaggagtttgacttggatgtggtg
gctgtggtgaatgatacggtgggcacgatgatgacttgtgcttatgaagacccaaactgt
gaaattggactcattgtgggaactggcagcaatgcctgttacatggaagagatgagaaac
atagagatggtggatggtgagcaaggacggatgtgtgtgaacatggagtggggagcgttc
ggggataatggatgcctggacgatatcaggacaatatatgacaaagcggttgatgacttt
tcactaaatgctggaaagcaaaggtacgagaaaatgatcagtgggatgtacctgggggaa
atagtccgcaatattttgatcgacttcaccaagcgggggttcctgttcagaggccagatt
tcagagacgttgaagaccaggcatatctttgaaaccaagttcctttcacagatcgagagc
gacaggttagctttgcttcaggtgcgaaccatactccagcagctggggctcaacagcacc
tgcgatgacagtatcattgtcaagaccgtgtgtggagcagtgtcgaagcgagcggctcag
ttgtgcggggctggcatggctgcagttgtagataaaattcgggagaacaggggattagag
cacctggagattacggttggtgtggacgggacgctgtacaagctacacccacacttttcg
aggattatgcaccaaacagtcaaagacctggcacccaagtgcgatgtgaccttcctgctt
tcggaagacggcagtgggaaaggggcagcgctcatcacggcggtgggatgcaggcttcgt
gatgccgagcagaactga

DBGET integrated database retrieval system