KEGG   Anser cygnoides domesticus (swan goose): 106038840Help
Entry
106038840         CDS       T04896                                 

Gene name
SUV420H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1 isoform X1
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:acyg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106038840 (SUV420H1)
Enzymes [BR:acyg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106038840 (SUV420H1)
Chromosome [BR:acyg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106038840 (SUV420H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 857 aa AA seqDB search
MKWLGESKNMVVNGRRSGSKSSNDHAQNQTKLQHAGKENPKTGKNGVERRSNRCSGASGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIER
FKKDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRY
SSEQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNCAQL
WLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYT
CERRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDAD
TTQEKANATNRKSSIGVKKNGKNRTLTRQSISRIPASSNSTSSKLTHLNNSRVPKRLKKP
AKPLLSKIKLRNQCKRPEQKNASRKLEMGNLVLKEPKVVLYKNLPIKKDKELEGPVKVAV
SSGCLTRHAAREYKLNSVKGAHEHGDIPPCTYITRRSMRTRMNLKETSDIKLEPNTLDSY
KNNLTGTRSDVLEQQSHVTNENDLAHGASHKGEVRCQKNDAGMSKKKSRQGKLAKPPAKT
DETDSTHNTPVTDEVPDLISSHSEHGDRNNVVETPVSYKDCVPGSGGCSVVTSDNFKAKD
SFRTAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQENDGMNSSKISIKL
SKDHEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREEENRGTYPEDLHENGVCCSETLS
LLESRMEVDDYAQYEEETADESSSEEDDEEEDDYDDEFDDFIPLPPAKRLRLIVGKDSID
IDISSRRREDQSLRLNA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggagaatccaagaacatggtggtgaatggcaggagaagtggaagcaag
tcgtctaatgaccatgcacagaatcagaccaaattgcagcatgcaggaaaggagaatccg
aagactggcaaaaatggagttgagagaagatcaaatagatgtagcggtgcttcaggattt
gagggtcaaagtcgttatgtgccttcctctggaatgtctgccaaggaactgtgtgaaaac
gatgacctagcaactagcttggttcttgatccctatttaggttttcagacacacaaaatg
aatactagatttcgacctataaaaggaaggcaagaagaactaaaagaggtgattgaacgt
tttaagaaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgactgggcc
cggcactattttcttaacaagaacaaaatgcaggaaaggttgttcaaggaacatgtattt
atttatttacggatgtttgcaactgacagtgggtttgagatactgccttgtaatcggtat
tcttctgagcaaaatggagccaaaatagttgcaacaaaagaatggaaacggaatgataaa
atagaattactcgttgggtgtattgccgaactatcagaaatggaagaaaacatgctgctg
agacatggtgagaatgacttcagtgtaatgtattccacacggaaaaactgtgcacaactg
tggctcggtcctgctgcatttatcaatcatgattgcagacctaactgtaagtttgtgtca
actggacgagatacagcatgtgtgaaagctctaagagatattgagcctggagaagaaatc
tcttgttactacggagatggcttttttggagaaaataatgaatactgcgaatgttacacc
tgtgaaagacgcggaactggtgcttttaaatcaagagtgggattgccagcacctactcct
gtgattaatagtaaatatggactgagagaaacagataaacgattgaatagactcaaaaag
ttgggtgacagcagcaaaaattcagacagccagtctgtcagctctaacactgatgcagat
accactcaggaaaaagctaatgcaactaacagaaaatcttcaattggtgtaaaaaagaac
ggcaaaaatagaacattaaccagacagtctatatcaagaattccagcatcatcaaattct
acctcatctaaactaactcatctaaataattccagggtaccaaagagactgaaaaagcct
gcaaagcctttactttcgaagattaagctgaggaatcagtgcaaaaggccagagcagaag
aacgcttctagaaagctcgaaatgggaaatttagttctcaaagagcctaaagtagtttta
tataaaaacttgcccattaaaaaagataaagaattagagggaccagtcaaagttgcagtc
tctagtggatgcttaacaaggcatgcagcaagggagtataaactgaattctgtgaaaggt
gctcatgagcatggtgatataccaccctgcacatacataacaaggaggtcaatgagaaca
aggatgaatttgaaggagacctctgacataaagcttgaaccaaatacattggatagctat
aagaataacttgactggaacgcgatcggacgttttagagcagcagtctcatgtgacgaat
gaaaatgacctggctcatggagcatcgcataaaggggaggttaggtgccagaaaaacgat
gcaggcatgtcaaaaaagaagtctcgacaaggaaaactggcaaaaccacctgcaaaaaca
gatgaaactgatagtacgcacaacacacctgtgactgatgaagtaccagatttgatcagt
tctcattcagaacacggagataggaataatgtggtagagacacctgttagctataaagac
tgtgtccctggatctggtggctgctctgttgtaacatctgacaattttaaagcgaaggac
agctttagaactgcaaaaagtaaaaagaaaagacgaatcacaaggtatgatgcacaacta
atccttgaaaatagctctgggatccctaaactgactcttcgtagacgccacgatagcagt
agcaaggcaaatgaccaagaaaatgatggaatgaattcttcaaaaataagcatcaaatta
agtaaagaccatgaaaaagataataatttatatgtagcaaagctaaataatgggtttaac
tcaggatcaggcaatagttcaacaaaattaaaaatacagctaaaacgagaggaagaaaac
cgagggacgtaccctgaggaccttcatgaaaatggtgtgtgttgtagtgaaactctctcc
cttttggagtcgagaatggaagtagatgattatgctcagtatgaggaggaaacagcagat
gaatcttcatcagaagaagatgatgaagaggaagatgattatgatgatgaatttgatgac
tttattcctcttcctccagcaaagagattaaggctcattgttggcaaggattcaatagat
attgatatttcttccaggaggagagaagatcagtctttaaggctcaatgcataa

DBGET integrated database retrieval system