KEGG   Anser cygnoides domesticus (swan goose): 106039133Help
Entry
106039133         CDS       T04896                                 

Gene name
NEU4
Definition
(RefSeq) LOW QUALITY PROTEIN: sialidase-4
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:acyg00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    106039133 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106039133 (NEU4)
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     106039133 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 540 aa AA seqDB search
MPCHGSHPVPCQPRFTGSPTPRGVLPSTFPQILPGQGQCHQPPARSGAAPLSAAGTMGSR
HFPARTVLFEKETSGVTYRVPALLYLPCVAKLLAFAEERLSADDAHANLLVLRRGTVYSG
YVEVGAGPTPRGGWIRPGAGWGGVXPLCPVPVQWEDMRVLETATLQHHRSMNPCPLYDEF
TGTLFLFFITVLGRTPEAFQIVTGQNVTRLCCVTSADQGLSWSKATDLTQQVIGRAIKDW
ATFALGPGHGIQLRSGRLLVPAYSYHIDCKECFGQLCKTTPHSFAFYSDDHGRGWRFGEF
IPNLQTGECQLVSVDEEDGSNVLYCNARSPLGFRVQALSTDDGAVFHGGQLVQRLVEPPH
GCHGSVVGFPAPFVYGPQPPDVPGQGSAPRPLPRFRDLLALRAAGDKLQVDPKATSGPGT
FFQAPTWVLYSHPTSPMSRVNMGVHLSTFPRDAESWTEPWVIYEGPSAYSDLAYMELPHS
QAPVSGGPAIAFACLYENGRRSPYEQISFSMFTLHDVLQNIPLTAAVPCRKRRRRSCCVS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgccctgccatggctcccaccctgtcccttgccagcctcggtttactgggagccccact
ccacgcggtgtcctgcccagcacctttccccaaatcctacctgggcaggggcagtgccac
cagccccctgcccgcagtggggccgcccctctctctgccgcaggcaccatgggctcccgg
cacttccctgcccggactgtgctcttcgagaaggagaccagcggcgtcacgtaccgcgtg
ccggccctgctctacctgccctgcgtggccaagctgctggcctttgctgaggagcggctg
agcgccgacgacgcccacgccaacctgctggtgctgcgccgcggcaccgtctacagcggc
tatgtggaggtgggagcggggccgacaccgcgggggggctggatcaggcccggggcgggc
tggggaggggtctgaccgctctgccccgtccccgtgcagtgggaagacatgcgggtgctt
gagacggcgacgctgcagcaccaccggtcgatgaacccctgcccgctctatgacgagttc
acgggcaccctcttcctcttcttcatcacggtgctgggcaggacacctgaagccttccag
attgtcacgggccagaacgtcacccgcctgtgctgcgtcaccagtgccgaccagggtctg
agctggagcaaggccacagacctgacgcagcaggtcatcggcagggccatcaaagactgg
gccacctttgcactgggccccgggcatgggatccagctgcgctccggccgactgctggtg
cccgcctacagctaccacattgactgcaaggagtgcttcgggcagctctgcaagaccacc
cctcactccttcgccttctacagcgacgaccacggccggggctggcgtttcggggagttc
atccccaacctgcagacgggcgagtgccagctggtctcggtggatgaggaggatggctcc
aatgtcctctactgcaacgcccgcagccccctgggcttccgcgtccaggcactgagcacc
gatgacggggctgtcttccacggggggcagctggtccagcggctggtcgagcccccccac
gggtgccacggcagtgtcgtcggcttccctgcacccttcgtgtacggcccccagccccct
gacgtccctggacaaggctcggctccgcggccgctcccccgttttcgggacctgcttgcc
ttgagggcagcaggggataagctccaagtggaccccaaagccacctccggccccggcacc
ttcttccaagcaccaacgtgggtgctctactcccaccccaccagccccatgtcgcgggtc
aacatgggggttcacctcagcactttccccagggatgcagagagctggaccgaaccctgg
gtcatctacgagggtccgagtgcatattcggacctggcttacatggagctgccccacagc
caggcccccgtctctggtggcccggccattgcttttgcctgcctctacgagaacgggagg
cggtccccctatgagcagatatccttcagcatgttcacgctgcacgatgtgctccagaac
atccccctgacggctgcagtgccctgcaggaagcggaggcgaaggagctgctgtgtctcc
tag

DBGET integrated database retrieval system