KEGG   Anser cygnoides domesticus (swan goose): 106040639Help
Entry
106040639         CDS       T04896                                 

Gene name
PTGS1
Definition
(RefSeq) LOW QUALITY PROTEIN: prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg00590  Arachidonic acid metabolism
acyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acyg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    106040639 (PTGS1)
Enzymes [BR:acyg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106040639 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 106040639
NCBI-ProteinID: XP_013044119
LinkDB All DBs
Position
Unknown
AA seq 583 aa AA seqDB search
MAGDLSGSLPAVNPCCYYPCQHQGVCVRVGLEGYECDCTRTGYFGANCTSPELWTRLHNL
LKPSPAFYHFVLTHFRWFWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSNYGYISWEA
YANVSYYTRILPPVPDDCPTPMGTKGKRQLPDAQFLAERFLLRHKFEADPRGTNLMFAFF
AQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFRDGKLKFQVVDGEV
YPPSVIEAPVHMVYPPAIPKEKQLAMGQEVFGLLPGLCMYATLWLREHNRVCDILKREHP
TWSDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLSLKFDPELLFGRQFQYRNRIAVEF
NQLYHWHGLMPDSFVIQGEAYSYEQFLYNTSMLLDYGVEALVESFSKQAAGMIGGGQTIN
ANVLKVAVGVIKESAGXXXXXXXAPARKRFGMKPYTSFQELTGEEEKAAELEELYGDIDA
LEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLLGNPICSPEYWKPSTFGGATGFEIVK
TASLEKLVCLNVKRCPYVAFRVPDAVAGGTASSSQGGGPSTEL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgacctctctggctctctccccgcagtgaacccgtgttgctattacccctgc
cagcaccaaggggtgtgcgtgcgggtcggcctggaaggctacgagtgcgactgcacgcgg
acggggtacttcggggctaactgcacctcgcccgaactctggacgcgcctccacaacctg
ctgaagcccagtcctgccttctaccacttcgtcctgactcacttcaggtggttttgggac
atcatcaacagcaccttcatcagggacacgctgatgaggctcgtgctcacagttcgtgcc
aatctcatccccagcccccccacctttaactccaactacggctacatcagctgggaggcc
tacgccaacgtcagctactacacccgcatcctcccgccggtgccggacgactgccccacg
cccatggggaccaaagggaagcggcagctccccgacgcccagttcctggcggagaggttc
ctgctgcggcacaagtttgaagccgatccccggggcaccaacctgatgtttgccttcttc
gcccagcatttcacccaccagttcttcaagacgtccgggaagatggggcgcggcttcacc
aaggcgctggggcacggggtggacctggggcacttgtacggggacaacctgcagcggcag
caccagctgaggctcttcagggatgggaagctcaaattccaggtggtggatggagaggtg
taccccccctcggtcatcgaagcgccggtccacatggtgtacccgcctgccatccccaag
gagaagcagctggcgatgggtcaggaggtgttcgggctcctgccggggctctgcatgtac
gccacgctctggctgcgcgagcacaaccgcgtctgcgacatcctgaagcgggagcacccc
acctggagcgatgagcagctcttccagacggctcggctcatcctcatcggggagaccatc
aagatcgtcattgaagactacgtccagcacctcagcgggtacttcctgagcctcaagttt
gaccccgagctgctgttcgggaggcagttccagtaccggaatcgcatcgcggtggagttc
aaccagctctatcactggcacgggctgatgccggactccttcgtcatccagggggaagcg
tacagctacgagcagtttctctacaacacctccatgctcctggactatggcgtggaggcc
ctggtggagtccttttccaagcaggctgcggggatgatcggcggggggcaaaccatcaac
gccaacgtcctgaaagtggccgtcggggtcatcaaggagtccgctgggnnnnnnnnnnnn
nnnnnnnntgctcctgctcggaagaggtttggcatgaagccctacacgtccttccaggag
ctaacaggagaggaggagaaggcggcagagctggaggagctctatggagacatcgatgcg
ctggagttttatccgggcttgctgcttgagaaaccccaacccaacggcattttcggagaa
agcatggtggagatcggagctccgttttccctgaaggggcttctcggaaaccccatctgc
tccccagagtactggaaacccagtacctttggcggagcaactggctttgagatagtcaag
acagcatccctggagaagctcgtgtgcctcaacgtgaagaggtgcccgtacgtggcgttc
cgggtgccggacgccgtggcaggaggcacagccagcagcagccagggcggtgggccgtct
acggagctctag

DBGET integrated database retrieval system