KEGG   Anser cygnoides domesticus (swan goose): 106048665Help
Entry
106048665         CDS       T04896                                 

Gene name
PCSK2
Definition
(RefSeq) neuroendocrine convertase 2 isoform X1
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     106048665 (PCSK2)
Peptidases [BR:acyg01002]
 Serine Peptidases
  Family S8: subtilisin family
   106048665 (PCSK2)
Chaperones and folding catalysts [BR:acyg03110]
 Intramolecular chaperones
  Subtilisin family
   106048665 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 587 aa AA seqDB search
MIKNSDPGLPFLDTGYFFYHNGIAKARRRRSLQHKLHLEKDSRVKKAVQQEGFSRRKRGY
RDINDIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGID
YLHPDLASNYNAQASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAY
NSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPRELTLQAMAD
GVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTL
ASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQH
LTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGG
SIQEPEKIPPSGKLLLTLTTDACEGKENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGT
KSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEIGFVGGEPHRGVLKEWTLML
HGTQSAPYIDQIVKDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaacagtgaccctgggctcccttttctagatactggttacttcttctatcac
aatggcattgccaaggccaggagaagacgcagtcttcaacacaagcttcacctggaaaag
gactccagggtaaagaaagccgtgcaacaagaaggcttcagcagaagaaagagaggatat
agagatatcaatgacattgacatcaacatgaatgatcctttatttacaaagcaatggtat
ctgattaacactggtcaagcagatgggactcctggacttgaccttaatgtagctgaagca
tgggagctcggatacacagggaaaggagttaccataggaattatggatgacggaattgat
tatctgcatcctgatcttgcctctaattataatgcccaagccagctacgacttcagcagt
aatgatccctacccttatccccgctacacagatgactggtttaacagccacgggacaaga
tgtgcaggagaggtgtctgctgctgccaacaacaacatctgtggtgtgggagtcgcgtac
aactccaaggtggcaggtattcgaatgctcgaccagccatttatgacagacattattgag
gcttcctctatcagtcatatgccccaagtcatagatatatacagtgccagctggggacca
actgataatggaaagactgtggatggacctagagagctaacactgcaagcgatggcggat
ggtgtgaacaagggccggggcgggaaaggaagcatctatgtctgggcttctggagatggg
ggcagctacgatgactgtaactgtgatggttatgcatcaagcatgtggacaatctccatc
aattccgctataaatgatggacggacagctctgtatgatgaaagctgctcttcaacccta
gcctccacctttagtaacgggaggaagagaaatccggaggctggtgtggctaccacagac
ttgtatggcaactgcaccctgcgtcactcaggaacgtctgcagctgcccctgaagcagcc
ggagtgttcgccttggccctggaggctaacttggatctgacatggagagacatgcagcat
ctgacagtcctcacctccaaaaggaaccagctccacgatgaagttcatcagtggcgcaga
aatggcgttgggctggaattcaaccacttgtttggctacggtgtcctagatgcaggagcg
atggttaagatggcaaaagactggaagaccgttcccgagcgattccactgtgttgggggg
tcaatacaggagcctgaaaagataccaccaagtggcaagctgctcctcacacttacaact
gatgcttgtgaggggaaggagaattttgtccgttaccttgaacacgtccaagcagttata
actgtgaattcaactaggcgaggagacctcaacatcaacatgacctcgccgatgggaaca
aaatccattctactgagccggcgtcccagggatgacgactccaaggtgggttttgacaaa
tggcctttcatgaccacacacacttggggagaagaccccagaggcacatgggtcctagag
attgggtttgtcggcggtgagccacatcggggcgtgctgaaggagtggacactgatgctg
catgggacccagagtgcaccatatatagaccaaatagtaaaagattatcagtccaaactg
gccatgtctaagaaggaagagctggaagaagaattagatgaagcagtggagagaagcctg
aagagtatactgagcaagaactag

DBGET integrated database retrieval system