KEGG   Anser cygnoides domesticus (swan goose): 106049424Help
Entry
106049424         CDS       T04896                                 

Definition
(RefSeq) putative serine protease 41
Organism
acyg  Anser cygnoides domesticus (swan goose)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MARDGHGAFNFTPIFILMVGLLSATPLLAQNGKGGNEGDELPEVDESRIIGGKPCSITQR
PFQVALIKRGQILCGGSLIDAQWVLTAAHCKQPGRDLRVLIGTDTLRDGTGEVRMISQLI
VHPAYNPRKNDNDFMLLRLNRPVQFSNNIKKIRLATRCPMDGMRCSVSGWGTTKSPGAKL
PRNLQCAGVQAFGKDKCARAYGRLITPNMFCAGVPQGGIDSCQGDSGGPLVCNGVLQGVV
SWGMAVCGRKGQPGVYSNVSATGDENRIVGGHSCQKKHHPYQAVLLGPQNNIHCGGVLID
KFWVLTAAHCDTKRSIPIRMGDHSLKTKEGTEQCINSAQAFVHPGYNPTTHDNDIMLLKL
QKPVRFTDHVQPVALPRRCPPPNTECIVSGWGSTSSPEGYFPDILQCGVVYTISNEECSK
LYPKGITRNMICAGLSSGGTDSCQGDSGGPLVCKDELQGIVSWGMQVCGRRGKPGVYTRV
CEFTAWIHDTIRRKSHA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgacgggcatggggccttcaacttcacccccatcttcatcctcatggtggga
ctgctgtccgccaccccgctgctggcacaaaacgggaaggggggcaatgaaggcgatgag
ctaccggaggtggacgagtcccgtatcatcggtgggaagccctgctccatcacccagcga
cctttccaggttgccctcatcaagaggggacaaatcctgtgtggaggaagcttgatagac
gcccagtgggtcctgacagccgcccactgcaagcagccaggcagggacctcagggtgtta
atcgggacggacacgttgcgggatggcacgggggaagtgaggatgatttcgcagttaatc
gtccacccggcctacaacccccgcaagaacgacaacgacttcatgctcctgaggctgaac
agacctgtgcagtttagcaacaacatcaagaagatcagattggccacgaggtgtcccatg
gacgggatgaggtgcagcgtgtctggctggggcacgaccaagtcccccggagcaaagctc
cccagaaatctgcagtgtgccggcgtccaagccttcgggaaggataagtgcgcgagggcg
tacgggaggttgatcacccccaacatgttctgtgccggcgtcccccaggggggcatcgat
tcctgccagggcgactccgggggcccgctggtgtgcaacggggtgctgcaaggcgtggtg
tcgtggggcatggctgtctgcgggcgcaaggggcagcccggcgtctactccaacgtgtcg
gccacgggggacgagaaccggatcgtggggggccacagctgccagaagaagcaccacccg
taccaggcggtcctgctgggcccccagaacaacatccactgcggcggggtcctcatcgac
aagttctgggtgctgacggccgcccactgcgacaccaagaggtccatccccatccgcatg
ggcgaccacagcctgaagaccaaggaggggacggagcagtgcatcaactcggcccaggcc
ttcgtccaccccggctacaaccccaccacccacgacaacgacatcatgctgctgaagctc
cagaagcccgtgcgcttcaccgaccacgtccagcccgtggccctccccaggagatgcccg
ccgcccaataccgagtgcatcgtgtcgggctggggcagcaccagcagccctgaaggctac
ttccccgacatcctccagtgcggtgtggtctacaccatctccaacgaggagtgcagcaag
ctctaccccaagggcatcaccaggaacatgatctgcgccgggctcagctcggggggcacc
gactcctgccagggtgactcgggtgggccactggtgtgcaaggacgagctgcagggcatt
gtctcgtggggcatgcaagtgtgcgggcggcggggcaagcccggcgtctacacccgcgtc
tgcgagttcaccgcctggatccacgacaccatcaggaggaagagccacgcttga

DBGET integrated database retrieval system