KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0389Help
Entry
Adeh_0389         CDS       T00326                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
455643..457403
Genome map
AA seq 586 aa AA seqDB search
MRLRGPPQPPPRHPTLAHALAAAAGHPSGATFLDLHERETFLSWSEVRARAERAAANLVH
LGIRRGDRVAIVLRTEPAFLDAFLGAWLAGAVPVPLYPPVRLGRLDAYAEDTGRMIRVAG
ARLVVSAGGTRRLLGGAVERGGPALGCVDVSALSALPARIAREPEPDALGLVQFSSGTTV
DPKPVALTHRALAAMADALVAATSAGPDDVLVSWLPLYHDMGLIGCLLAAMSYPGPLVLI
PPEHFLTRPALWLRALARKRGTISAAPSFAFAYAADRVRDADLAGLSLGTVRLLLDGAEP
VSAVALRGFAERFARHGLDPGALVPVYGLSEAALAVTFARPGGRLGGLGVDAARLASEGV
VAPGGREVVPVGTPVPGVEVELRGEGGMRVGEGRVGRVFVRGPALMREYLGDPGATARAL
RGGWLDTGDLGFVVGGALYLHGRARDLVIVRGANHAPEEFEAPLAALPGLRPGCAVALGF
EPAGGAGEALLVLAERARDEAAPDAELEARVRRAVLAATGIAPHTVRLLAPGTLPRTSSG
KLRRAEALRRFQAGTLAPPQPVSALRLALAAARSQLAFGRSRRRGG
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctccgcgggccgccccagccgccgccccggcacccgacgctggcgcacgcgctc
gccgccgcggccgggcacccctccggcgcgacgttcctcgacctgcacgagcgcgagacg
ttcctgtcctggtccgaggtccgcgcccgcgccgagcgcgccgcggcgaacctcgtccac
ctcggcatccggcgcggcgatcgcgtcgcgatcgtgctccgcaccgagcccgccttcctc
gacgcgttcctcggcgcctggctggcgggcgcggtgccggtcccgctctacccgccggtg
cggctgggccggctggacgcgtacgcggaggacacgggtcggatgatccgggtggccggg
gcgcggctcgtcgtctcggcgggcggcacgcggcggctgctcggcggcgcggtggagcgc
gggggcccggcgctcgggtgcgtggacgtgtcggcgctctcggcgctgcccgcccgcatc
gcgcgcgagcccgagcccgacgcgctcggcctggtgcagttctcctcgggcacgacggtc
gatccgaagccggtcgcgctcacccaccgcgcgctcgccgccatggccgacgcgctcgtc
gcggcgacgtcggcggggccggacgacgtgctcgtctcgtggctgccgctctaccacgac
atgggcctcatcggctgcctgctcgccgcgatgagctacccggggccgctggtgctcatc
ccccccgagcacttcctcacccgcccggcgctctggctgcgcgcgctggcccgcaagcgc
ggcacgatctccgccgcgcccagcttcgcgttcgcgtacgcggccgaccgggttcgcgac
gccgatctcgcgggcctgtcgctcgggaccgtgcggctgctgctcgacggcgccgagccg
gtgtcggcggtggcgctgcggggcttcgccgagcgcttcgcgcggcacgggctggatccg
ggggcgctcgtgcccgtgtacggcctcagcgaggcggcgctggcggtcacgttcgcgcgc
ccgggcggccgcctcggcgggctcggggtggacgcggcccggctcgcctcggagggcgtg
gtcgcgcccggcgggcgcgaggtggtgccggtggggaccccggtccccggggtcgaggtc
gagctccgcggcgagggcgggatgcgggtgggggaggggcgcgtcgggcgggtgttcgtc
cgcggcccggcgctcatgcgcgagtacctgggcgatcccggggcgaccgcgcgcgcgctg
cggggcgggtggctcgacaccggcgacctcgggttcgtggtgggcggcgcgctgtacctc
cacggccgcgcccgcgacctcgtgatcgtgcgcggcgcgaaccacgccccggaggagttc
gaggcgccgctcgcggcgctgcccggcctgcgcccgggctgcgcggtggcgctcggcttc
gagccggcgggcggcgcgggcgaggcgctgctcgtcctggcggagcgcgccagggacgag
gcggcccccgacgccgagctcgaggcgcgcgtccggcgcgcggtgctcgcggcgaccggc
atcgccccgcacacggtccggctgctcgcgcccggcacgctcccgcggacgtcctccggc
aagctgcggcgcgccgaggcgctgcgccggttccaggcggggacgctcgcgccgccgcag
ccggtgagcgcgctccgcctcgcgctcgccgccgcgcgctcgcagctcgccttcgggcgg
tcgcgccgccgcgggggctga

DBGET integrated database retrieval system