KEGG   Acropora digitifera (stony coral): 107338892Help
Entry
107338892         CDS       T04352                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
adf  Acropora digitifera (stony coral)
Brite
Enzymes [BR:adf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107338892
Peptidases [BR:adf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107338892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1189 aa AA seqDB search
MMAQCLALFLLFAVTGCASQSSVWSQCNKDLGLQSFWTPNSDVTASSILDSLHDPGQARL
HGKGAWMPLVQDSEQFLQIDFKGEVDLSAVAVQGHPKYEYWVTKFALSFSLDGKAWDELH
EVFNGSKSNNDVQTVYLPELTKLRFLRLKPTKWHAAIALRMEIYGCMKDNSRCGDRPKTP
HSRQKRIVGGKSAEPNSWPWQVEIAKTGNKHWCGGAIIHPRWILTAAHCADPFYSSDPSE
IRLGEHNRVKLDGYEEVLEGDRYFIHPGFKHARPSYVSPGNFDIALYRLKRPATFHSRVS
PVCMPDEDSTFPENVGRVCVVTGWGHTVENGSSFSDILQENQVPIVSRDECNKKDSYDGH
VNEHFMCAGFEGGGKDACQGDSGGPLVCQDGSGKWVLTGVVTWGVGCARPHKYGVYADVR
RLLPFIESTMYGHPECGIRTESSFEIPRVVGGREASPNSWPWQVDLLVNGTLHLCGGSLI
APSYIVTSAHCFLSNSQPSQWQVRVGEHNESIFEGFEEMIDIENITIHPGFTLGSYNDPG
DYDIAIIQLKRPAVFHKRVHSICLPGMETSFPAGKTCFTTGWGKQNESSTGYSKVLREVE
VDLVSKEVCNSNISYQGNINERYLCAGFQEGGKDACFGDSGGPLACQLGNGSYVLTGVVS
WGKGCARANNYGVYLDVRFMLPFIENTLYGYPSCGLRPVSPPMSRIVGGREGIPNSWPWQ
VDLLVNDTLHLCGGSLIAPSYIVTSAHCFLSNSQPSQWQVRVGEHNESIFEGFEEMIDIE
NITIHPGFTLGSYNDPGDYDIAIIQLKRPAVFHKRVHSICLPGMETSFPAGKTCFTTGWG
KQNESSTGYSKVLREVEVDLVSKEVCNSNISYQGNINERYLCAGFQEGGKDACFGDSGGP
LACQLGNGSYVLTGVVSWGKGCARANYYGVYLDVRFMLPFIENTLYGYPTCGSRFLATPN
LPVRNAGEARPNSWPWQVDLLFRSSHACSGALIDKSWIITSVECVNANEKPEDWVVRLGE
HRRMFLEGYEETIKVKEFVIDPQRHVALLKIERIAVLHQRVTTVCLPASEDYEFPVNGSS
CFVTGWKFNEQQGNISDVLIQSPVQLASRELCNTSYQGVLSHNEGCVYSSVDNPVCSVEK
GAPLVCPRADGQFVLAGVVSNENWCSNPGKFGVFVDIKTMLSFIRGSIM
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgcagtgtttagctctttttcttctttttgctgttacggggtgtgcatcacag
tcttcagtatggtcacaatgtaacaaagacctggggctgcagagcttttggactccaaac
tcggatgtcaccgcctcgtccattcttgattcgttgcatgacccgggacaggcccgtctg
catggaaaaggggcttggatgccacttgttcaagatagcgagcaatttttgcagattgat
ttcaagggcgaggtggatttgtctgctgtcgccgtacagggtcatcctaaatatgagtat
tgggtcacgaaatttgcgctgtcattcagtttagatggcaaagcgtgggacgagttacac
gaggtctttaatggaagcaaaagtaacaacgatgttcaaactgtttatctacctgagcta
acaaaactacgatttttgcgtttgaaacctaccaagtggcacgctgcgattgctctaaga
atggaaatttatggctgtatgaaagataattcaagatgtggagaccgtcccaaaacacca
cactcacgccaaaagcgaattgtagggggcaaaagtgcagagcccaactcatggccctgg
caagtggagattgcaaagacaggcaacaagcattggtgtggcggtgcaattattcatccc
cgttggattttaaccgctgcacattgtgcagatccattttatagctcagacccaagcgaa
atacgacttggagaacataaccgtgttaagctcgacggatacgaagaggttcttgagggt
gacagatattttatccatccaggattcaaacatgctcgacccagttatgtcagcccagga
aactttgacatagcactttaccgtctgaaacgaccggcgacttttcatagtagggtgagc
cctgtttgtatgcccgacgaggactcgacatttcccgaaaatgttggtcgggtgtgcgtc
gtaaccggctggggtcacactgtggaaaatgggagctcgttttctgacattcttcaagag
aatcaagtaccgatagtatcacgtgacgaatgcaataagaaagattcttatgatgggcac
gtcaatgaacatttcatgtgcgcaggatttgaaggaggaggaaaggatgcttgtcagggt
gacagtggtggtccactggtgtgtcaagatggctctgggaaatgggtgctcactggtgtt
gtgacgtggggtgttggatgtgcaaggcctcacaaatatggagtatacgctgatgtacga
agattacttccattcattgagagcacaatgtatggtcatccggaatgcggcattcgcaca
gagtcttctttcgagatcccacgcgtcgttggtggacgagaggccagccccaattcctgg
ccgtggcaagtcgaccttcttgtaaatggtactttgcatttatgtggaggatcactgatt
gccccttcttatattgtgacatctgcgcactgttttctcagcaacagtcagcctagccaa
tggcaagtcagagtaggtgaacacaatgaatcaattttcgaaggctttgaggaaatgatt
gatattgagaatataacgattcatcctgggtttacattggggagctacaatgaccctggt
gattatgacattgcgatcattcaactcaagaggcctgcggtcttccacaaacgagtgcac
tccatatgtctccccggtatggaaaccagttttccagctggcaaaacctgttttactacc
ggatggggaaagcaaaacgagagttctaccgggtactctaaggttctccgcgaagtcgag
gtggatctggtgtcaaaggaagtctgcaacagcaatatttcttaccaggggaatataaat
gaacgatatctatgcgctggttttcaagagggtggtaaagacgcttgttttggtgacagc
ggtgggcctctggcatgccaactaggaaacggaagttacgtattgacaggtgtggtgagt
tggggtaaaggatgcgcgagagcaaacaattatggagtgtacctagatgtgcggtttatg
ttgccattcattgagaacactctttacggttatccttcgtgtggacttcgtccagtctcg
cctccgatgtcacgaatcgtcggtggacgcgaaggtatccccaattcatggccgtggcaa
gtcgaccttcttgtaaatgatactttgcatttatgtggaggatcactgattgccccttct
tatattgtgacatctgcgcactgttttctcagcaacagtcagcctagccaatggcaagtc
agagtaggtgaacacaatgaatcaattttcgaaggctttgaggaaatgattgatattgag
aatataacgattcatcctgggtttacattggggagctacaatgaccctggtgattatgac
attgcgatcattcaactcaagaggcctgcggtcttccacaaacgagtgcactccatatgt
ctccccggtatggaaaccagttttccagctggcaaaacctgttttactaccggatgggga
aagcaaaacgagagttctaccgggtactctaaggttctccgcgaagtcgaggtggatctg
gtgtcaaaggaagtctgcaacagcaatatttcttaccaggggaatataaatgaacgatat
ctatgcgctggttttcaagagggtggtaaagacgcttgttttggtgacagcggtgggcct
ctggcatgccaactaggaaacggaagttacgtattgacaggcgtggtgagttggggtaaa
ggatgcgcgagagcaaactattacggagtgtacctagatgtgcggtttatgttgccattc
attgagaacactctttacggttatccaacatgcggaagtcgatttttggctacacccaac
cttccagtgagaaacgcaggtgaggctcgtcctaactcatggccttggcaagttgatttg
ttatttcgaagttcgcatgcgtgcagcggtgccctaatcgacaagagctggattataaca
tctgtagaatgtgtcaatgcgaatgaaaaaccagaagactgggtggtgcgactgggagaa
cacaggagaatgtttcttgaaggatacgaagagaccattaaagtaaaagaatttgttata
gaccctcaacgtcatgtggcgttattgaagatagagcgaattgctgtactgcatcagcgt
gtcactaccgtatgtttgccggcatctgaagactacgagtttccagtaaatggttccagc
tgttttgttactggttggaaatttaatgaacagcaagggaacatctccgatgtgctaatc
caatcgccagttcagttagcttctagagagctctgtaatacatcatatcaaggagttctc
agccataacgagggttgcgtttattcatctgtggacaaccctgtttgttctgttgaaaaa
ggggcgccattggtttgccctagggctgatggacagtttgttctggctggagtggtgtca
aacgaaaactggtgctcaaatcctggaaagtttggtgtctttgtagatatcaagactatg
ctttcgtttattcgaggtagtatcatgtaa

DBGET integrated database retrieval system