KEGG   Aeromonas dhakensis: CK627_02335Help
Entry
CK627_02335       CDS       T05186                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
adh  Aeromonas dhakensis
Brite
Translation factors [BR:adh03012]
 Eukaryotic Type
  Elongation factors
   CK627_02335 (tuf)
 Prokaryotic Type
   CK627_02335 (tuf)
Mitochondrial biogenesis [BR:adh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CK627_02335 (tuf)
Exosome [BR:adh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CK627_02335 (tuf)
  Exosomal proteins of breast cancer cells
   CK627_02335 (tuf)
  Exosomal proteins of colorectal cancer cells
   CK627_02335 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ASX09696
UniProt: A0A1A5WLT6
LinkDB All DBs
Position
complement(442821..444005)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITNVLAKHFGGKAFAFDQIDKAPEERERG
ITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVVRGSALKALE
GEAQWEEKILELAGHLDTYIPEPERAIDQPFLMPIEDVFSIAGRGTVVTGRVERGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGALLRGVKREDVERGQVLAKPGTIK
PHTKFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgagcgtaataaaccgcacgtaaacgtcggcaccatcggccac
gttgaccacggtaaaaccaccctgaccgccgccatcaccaacgtgctggccaagcacttc
ggtggtaaagctttcgccttcgaccagatcgacaaggcgccggaagagcgtgagcgtggt
atcaccatcaacacctcccacgtagaatacgacaccgctacccgtcactacgcccacgta
gactgcccgggtcacgccgactacgttaaaaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtagtagcagcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcatgaacaagtgcgacatg
gtagatgacgaagagctgctggaactggtcgagatggaagttcgcgaactgctgtccgag
tacgacttcccgggtgatgacctgccggtagtacgtggttccgcactgaaagcgctggaa
ggcgaagctcagtgggaagagaagatcctggaactggctggccacctggacacctacatt
ccggagccggagcgcgcaatcgaccagccgttcctgatgccgatcgaagacgtattctcc
atcgcaggccgtggtaccgtagtaaccggtcgtgtagagcgcggtatcgttaaagttggt
gaagaagtggaaatcgttggtatcaaagataccaccaagaccacttgtaccggcgttgaa
atgttccgcaaactgctggacgaaggtcgtgcaggtgagaacgttggcgcgctgctgcgt
ggcgtgaagcgtgaagacgtagagcgtggtcaggtactggccaagccgggcaccatcaag
ccgcacaccaagttcgaatctgaagtgtacgtgctgtccaaagaagaaggtggtcgtcac
accccgttcttcaaaggctaccgtccgcagttctacttccgtactaccgacgtgaccggt
accatcgaactgccggaaggcgtagagatggtcatgccgggcgacaacatcaagatggtt
gttaccctgattgccccgatcgcaatggacgacggcctgcgtttcgccatccgtgaaggt
ggccgtaccgtaggtgctggtgttgtagctaaagttatcgcttaa

DBGET integrated database retrieval system