KEGG   Alcanivorax dieselolei: B5T_02434Help
Entry
B5T_02434         CDS       T02259                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
adi  Alcanivorax dieselolei
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5T_02434 (mdh)
   00620 Pyruvate metabolism
    B5T_02434 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    B5T_02434 (mdh)
  Energy metabolism
   00680 Methane metabolism
    B5T_02434 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    B5T_02434 (mdh)
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     B5T_02434 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2676441..2677421
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEITPALEALKGVVMELEDC
AFPLVAGIVQTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKAINDNA
SKAIKVLVVGNPANTNALIAQRNAPDIDPRQFTAMTRLDHNRAMAQLANKLGKTVNDVKK
MTIWGNHSSTQYPDLHHCEVDGKVAVDQIEQDWYEADYIPTVQQRGAAIIKARGASSAAS
AANAAIDHMRSWALGTDEGDWVSMGIYSDGSYGIQEGLIYSFPCTCKDGDWSIVQGLENN
EFSKAKMQATEQELAEERDAVSHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacctgtacgcgtggcggtgactggcgccgctggtcaaatcagctactccctg
ctgttccgcatcgcttccggcgacatgctcggcaaggatcagccggtaatcctgcaattg
ctggaaatcacccccgctctggaagccctgaaaggggtggtgatggaactggaagactgc
gccttcccgctggtggccggtattgtgcaaaccgacgacgccaatgtggccttcaaggac
gccgactacgccctgctggtaggtgcccgtccccgtggcccgggcatggagcgcaaggat
ctgctggaagccaacgcggcgatcttctccgcccagggcaaggccatcaacgacaacgcc
agcaaagctatcaaagtgctggtggtgggtaacccggccaacaccaacgccctgatcgcc
cagcgcaacgcgccggacatcgacccgcgtcagttcaccgccatgacccgtctggaccac
aaccgcgccatggcgcagctggccaacaagctgggcaagaccgtcaacgacgtgaagaag
atgaccatctggggcaaccactcctccacccagtacccggatctgcatcactgcgaagtg
gacggtaaagtggccgtcgatcagatcgagcaggactggtacgaagcggactacatcccc
accgtgcaacagcgtggcgccgccatcatcaaggcccgtggcgcttcctccgccgcttcc
gccgccaacgccgccatcgaccacatgcgctcctgggcgctgggcaccgatgaaggtgac
tgggtttccatggggatctacagcgacggttcctacggtatccaggaaggtctgatctac
tccttcccctgcacctgcaaggacggcgactggagcatcgtccagggcctggaaaacaac
gagttctccaaagccaagatgcaggccaccgagcaggaactggccgaagagcgcgacgcg
gtaagccacctgctgccgtaa

DBGET integrated database retrieval system