KEGG   Alicycliphilus denitrificans K601: Alide2_4368Help
Entry
Alide2_4368       CDS       T01463                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00564  Glycerophospholipid metabolism
adk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Alide2_4368
Enzymes [BR:adk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Alide2_4368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 HI0933_like 3HCDH_N FAD_binding_3 Lycopene_cycl Pyr_redox Pyr_redox_3 GIDA Thi4
Motif
Other DBs
NCBI-ProteinID: AEB86674
UniProt: F4G8E9
LinkDB All DBs
Position
complement(4563950..4565548)
Genome map
AA seq 532 aa AA seqDB search
MNTPSQDPPLTTDRAELLARLAQPRTYDLAVVGGGATGLGVALDAAARGFSVVLVESHDF
AKGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLAFVMPSYKLWET
PFYGVGLKMYDALAGQAGLGATEFLGRMDTLRCLPTVRAEGLKGGVKYWDGQFDDARLAL
ALARTAAQRGALLVNYCPARGLLHEGGKLVGLVCEDAETGRRFDLRARAVVNATGVWVDE
LRQQDGQALGRPVRPMVAPSQGVHIVVDREFLPSDHALLVPKTADGRVLFAVPWLGKLIL
GTTDSPRQDLAREPLAFKEEVDFILNESAKYLRRAPLPEDVRSIWVGLRPLVKPQDDEGG
NTKAISREHTVLASASGLVTVTGGKWTTYRAMAEDVLKKCFDEGLLPARAAGVTQRLPLA
GAPLEPPRRRMCDAQGLHSYGLDAAAVLQLPGADQWLAEGLSEAMVRFAARHEYARTVED
MLARRSRLLFLDARLAARLAPRVAAILQEELGRDPQLAAFQALAQQYQHLPA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaacactccaagccaagacccgcccctgaccaccgaccgtgccgagctgctggcgcgc
ctggcccagccccgcacctacgacctggcggtggtcggcggcggcgccaccggcctgggc
gtggcgctggacgctgcagcccggggcttttccgtggtgctggtggagtcgcacgacttc
gccaagggcacctcctcgcgcgccaccaagctcgtgcacggcggcgtgcgctacctggcc
cagggcaacatcgccctggtgcgcgaggcgctgcacgagcgcaccacgctgctgcacaat
gcgccgcacctggcgcagccgctggccttcgtcatgccctcgtacaagctgtgggagacg
ccgttctacggcgtgggcctgaagatgtacgacgccctggccggccaggccggcctgggc
gcgaccgaattcctcgggcgcatggatacgctgcgctgcctgcccacggtgcgcgccgag
gggctcaagggcggcgtcaagtactgggacggccagttcgacgatgcccgcctggccctg
gccctggcgcgcacggccgcgcagcggggcgcgctgctggtcaactactgccccgcgcgc
ggcctgctgcacgagggcggcaagctcgtcggcctggtctgcgaggacgcggagaccggc
cggcgcttcgatctgcgcgcgcgcgccgtggtcaacgccaccggcgtgtgggtggacgaa
ctgcgccagcaggacggccaggccctgggccggcccgtgcggcccatggtcgcgcccagc
cagggcgtgcacatcgtcgtggaccgcgaattcctgccctccgaccacgccctgctcgtg
cccaagacggcggacggacgcgtgctctttgccgtgccctggctgggcaagctcatcctg
ggcaccaccgacagcccgcgccaggacctggcgcgcgagccgctcgcgttcaaggaagag
gtcgatttcatcctgaacgagtcggccaagtacctgcgccgcgcgccgctccccgaggac
gttcgcagcatctgggtgggtcttcgcccgctggtcaagccgcaggacgacgagggcggc
aacaccaaggccatcagccgcgagcacacggtgctggccagcgcaagcggcctggtcacc
gtcaccggtggcaaatggaccacctaccgcgccatggccgaggacgtgctgaaaaaatgc
ttcgacgagggcctgctgcccgcgcgggcggccggcgtcacccagcggctgcccctggca
ggggcgcccctggagccgccgcgccggcgcatgtgcgatgcgcaggggctgcactcctat
ggcctcgacgcggctgccgtgctgcagctgcctggcgcggaccagtggctggccgaaggc
ctgagcgaggccatggtgcgcttcgcggcgcgccatgaatacgcgcgcacggtggaagac
atgctggcgcggcgcagccgcctgctgttcctcgacgcgcgcctggccgcccggctggcc
ccgcgcgtggcggccatcctgcaggaagaactggggcgagatccgcagctggcggccttc
caagccctggcgcagcagtaccagcacctgcccgcctga

DBGET integrated database retrieval system